KEGG   Leptotrichia sp. oral taxon 498: BCB68_00395Help
Entry
BCB68_00395       CDS       T04995                                 

Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
leq  Leptotrichia sp. oral taxon 498
Pathway
leq00010  Glycolysis / Gluconeogenesis
leq00051  Fructose and mannose metabolism
leq01100  Metabolic pathways
leq01110  Biosynthesis of secondary metabolites
leq01120  Microbial metabolism in diverse environments
leq01130  Biosynthesis of antibiotics
leq01200  Carbon metabolism
leq01230  Biosynthesis of amino acids
Module
leq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
leq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:leq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB68_00395
   00051 Fructose and mannose metabolism
    BCB68_00395
   00562 Inositol phosphate metabolism
    BCB68_00395
Enzymes [BR:leq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCB68_00395
Exosome [BR:leq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCB68_00395
  Exosomal proteins of bladder cancer cells
   BCB68_00395
  Exosomal proteins of melanoma cells
   BCB68_00395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ASQ47562
UniProt: A0A222P6V3
LinkDB All DBs
Position
98437..99204
Genome map
AA seq 255 aa AA seqDB search
MRKVIVAGNWKMNKTAKEAGEFFAEFKPLVKDVKNAGIIIGAPFTALETAVRETKGTNIK
IAAENMNAKESGAYTGEVSPLMLKDLGVEYVILGHSERREYYGETNEIINEKVKSALAHD
LKPILCIGEKLEEREANTTEDVVKSQIIGGLKDVTADQMANIILAYEPVWAIGTGKTATP
AQAQEVHAFIRSLLTDLFGAQVAENVTVQYGGSMNDGNAAELIAQKDIDGGLVGGASLVP
AKFTVIVKAGDAVTK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtaattgtagcaggaaactggaaaatgaataaaactgcaaaagaagcagga
gaattttttgcagaattcaaaccattagtaaaagatgttaaaaatgctggaattataatt
ggtgcaccttttacagcattagaaacagctgttagagaaactaaaggaacaaacattaaa
atcgcagctgaaaatatgaatgctaaagaaagcggagcttacacaggagaagtttcacct
ttgatgctaaaagacttaggtgttgaatatgtaattttaggacattctgaaagaagagaa
tattacggagaaactaacgaaatcattaacgaaaaagtaaaatcagcattagcacacgat
ttaaaaccaattttatgtatcggtgaaaaattggaagaaagagaagcaaatacaactgaa
gatgtggttaagagccaaattattggtggattaaaagatgtaactgctgaccaaatggca
aatataattttagcatacgaaccagtttgggcaatcggaacaggaaaaaccgcaactcct
gcacaagctcaagaagttcacgcattcataagaagtttattaacagatttatttggtgca
caagttgctgaaaatgtaacagttcaatatggtggatcaatgaatgacggaaatgccgct
gaattaatcgctcaaaaagatatcgatggtggattagttggtggagcaagtctagttcct
gcaaaattcacagtaatagtaaaagctggagatgcagtaactaaatag

DBGET integrated database retrieval system