KEGG   Leptotrichia sp. oral taxon 498: BCB68_02145Help
Entry
BCB68_02145       CDS       T04995                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
leq  Leptotrichia sp. oral taxon 498
Brite
KEGG Orthology (KO) [BR:leq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCB68_02145
Enzymes [BR:leq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BCB68_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 K_oxygenase DAO FAD_oxidored Lycopene_cycl Thi4 AlaDh_PNT_C 3HCDH_N FMO-like ADH_zinc_N NAD_binding_8 CLP1_N
Motif
Other DBs
NCBI-ProteinID: ASQ47871
UniProt: A0A222P7R1
LinkDB All DBs
Position
complement(475191..476174)
Genome map
AA seq 327 aa AA seqDB search
MDFSLNLGVLDEGKLQKIDENKLYDVAVIGAGPAAVSSAIYAARKGLAVAMVGVKVGGQV
LDTNEIENIIGTISTTGSKFAETLHNHLKEYAIAFKEGHVVKEISLDGKDKIFVTDDGKK
YKTKAIILATGAKPRSLNIPGEAEYVGKGVHYCSTCDGPFYKGLDVAVIGGGNSGVEAAL
DMSGIAKNVTLIEFMPELKADKVLQEKLAQRENVNVILNSATTEVLGTEFVENLKYKNRA
TNEEKTLKLDGIFIEVGLSPSSEIVKDLVELNKVGEIVINPLNNETSVEGIFAAGDVTSI
KQKQIIVAMGEGAKAALSAFDYLITKY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggattttagtttaaatttaggtgttttggatgaaggaaaactacaaaaaattgatgaa
aataaactttatgacgtggctgttattggagcgggaccagcagcggtctctagtgcgatt
tatgcggctcgtaaaggtttagctgttgcgatggtcggagtaaaagtgggtggacaagtt
ttggatacaaacgaaattgaaaatataataggaacaatttctacaactggaagcaaattt
gccgaaactttgcacaatcatttaaaggagtatgcaattgcgtttaaagaagggcatgtt
gtaaaagaaatttcgcttgatggaaaagataaaatttttgtcactgacgatggaaaaaaa
tataagacaaaagctataattttagcaactggtgcaaaacctagaagtcttaatattcct
ggagaagctgaatatgttggaaaaggagtgcattactgctcaacttgtgacggacctttt
tacaaaggacttgatgtcgctgtaattggtggtggaaactcaggcgtggaagctgcactt
gatatgtcggggattgcaaaaaatgttacattaattgaatttatgccagaattgaaagcc
gacaaagttttacaggaaaaattggcccagcgtgaaaatgtgaatgtaattttaaattca
gcaactacggaagttttaggaacagaatttgtggaaaatttaaaatataaaaatcgagct
acaaacgaagaaaaaactttaaaattggacggaatatttattgaagtaggactttctcca
agcagtgaaattgtaaaagatttagttgaattgaataaagtgggggaaattgtaataaat
ccattaaataatgaaacttcggtggaaggaatctttgctgcaggagatgttacaagcata
aaacaaaaacaaataattgttgcaatgggagagggtgcaaaagcagcacttagcgcattt
gattatttaatcacaaaatattaa

DBGET integrated database retrieval system