KEGG   Leptotrichia sp. oral taxon 498: BCB68_02470Help
Entry
BCB68_02470       CDS       T04995                                 

Definition
(GenBank) molecular chaperone Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
leq  Leptotrichia sp. oral taxon 498
Brite
KEGG Orthology (KO) [BR:leq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:leq03110]
    BCB68_02470
Chaperones and folding catalysts [BR:leq03110]
 Heat shock proteins
  HSP33
   BCB68_02470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 PyrI_C
Motif
Other DBs
NCBI-ProteinID: ASQ47930
UniProt: A0A222P7U0
LinkDB All DBs
Position
complement(542383..543321)
Genome map
AA seq 312 aa AA seqDB search
MGKKSELIRGTSKCARFFVCDTTQVVKEVQNIHRLDAIATVNFGKLLTAAAMMGKDLKVA
DGLISVEISGDGAYGKMVATANMKGHVKGYVGNTSNAKLVDKDGNFVRDEKGRIKLIGDG
IMQVRKDIGLKMPFSGMVALENQDIADIVASYFLQSEQIKSVVALGVKLNEDGSVNRAGG
YLIQLLPGAEDDFIDKLEDKLRKIRSITELLNGGFSLERIVELLYEDISVFEETEDVDGN
HKKKYVENFEILEKSEIEYKCNCSRETFLKGLITLGKEQIDEILKEQGKIEVECHFCGKK
HQFEKKDFEGVF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaatcagaattgataagagggacaagtaaatgtgccagattttttgtctgt
gatactacacaagttgtgaaagaagtacaaaatatacacagactggatgcgattgcaaca
gttaattttggaaaactgcttactgccgcagctatgatgggaaaggatttgaaagtggca
gatggacttatttcggtggaaataagcggtgacggagcttatgggaaaatggttgcaact
gcgaatatgaaaggccatgtaaaaggatatgttggaaatacttcaaatgctaaacttgta
gacaaagatggaaatttcgtgagagatgaaaaagggagaattaaacttattggcgatgga
ataatgcaagttagaaaagatattggactaaaaatgcctttttcaggaatggttgcgcta
gaaaaccaagatatagcagatattgttgcaagttattttttacagtcggaacaaataaag
tcagttgttgcacttggagtaaaacttaacgaagatggaagcgtgaatcgtgcaggaggt
tatttaattcagcttcttcctggcgcagaagatgattttatagataaactggaagataag
ttaagaaaaattagaagtattacagaattattaaatggtggatttagtcttgagagaata
gttgagcttttgtatgaagatatttcggtgtttgaagaaactgaagatgttgatggaaat
cataaaaagaagtatgttgaaaattttgaaattttggaaaaaagtgaaattgagtataaa
tgtaactgttcaagagaaacatttttaaagggtttaatcactttgggaaaagagcaaatt
gatgaaatcttgaaagagcaagggaaaattgaagtggaatgtcatttttgtgggaaaaaa
caccaatttgaaaaaaaagattttgaaggagtattttaa

DBGET integrated database retrieval system