KEGG   Leptotrichia sp. oral taxon 498: BCB68_06425Help
Entry
BCB68_06425       CDS       T04995                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
leq  Leptotrichia sp. oral taxon 498
Pathway
leq00500  Starch and sucrose metabolism
leq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:leq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BCB68_06425
Enzymes [BR:leq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BCB68_06425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ASQ48588
UniProt: A0A222P9R4
LinkDB All DBs
Position
1304048..1305496
Genome map
AA seq 482 aa AA seqDB search
MLNGVMIQYFEWNLADDGKHWERLKNDAAHLKEIGVSAVWIPPAYKGTFSGDVGYSAYDL
WDLGEFNQKGTVRTKYGTKEELIDAINELHKYGINVYLDAVLNHKGGADETERFLAIEVD
PENRNEEISEPKEIEGWTKFTFPGRNKKYSEFEWNHALFSGVDYDNLTGKTAIYKIAGEN
KGWAENVDSELGNYDYLMNADVDYSHPEVRNEIINWGKWVVNELNLDGFRMDAVKHISED
FIKEFLIEVRKVYGEKFYSVGEYWKGDLDTLKTYLENIGYETDLFDVGLHFNFHEASVEK
ENYDLTTILDNSIMLMDPIKAVTFVDNHDSQKGSALESEIESWFIPHAYAIILLSEKGYP
CLFYGDYYGVGDNKSPHGWVIDKLLYVRRNNAYGEQINYFDDPNIIAFYRKGRENEINTG
CVAILSNNEDGEKAIEIGKDRIGQVWEEVTGSGFEDVAIDEEGNAAFRVEGQKIAVWVPK
KQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatggagtaatgatacaatattttgagtggaatttagctgatgatggaaaacat
tgggaaagattaaaaaatgatgccgctcatctaaaagaaattggagtttcagcagtttgg
attcctcctgcctataaaggaactttttcaggggatgttggatacagtgcttatgatttg
tgggatttgggagagtttaatcaaaaaggaactgtgcgtacaaaatacggaacaaaagaa
gaactcattgatgcgattaatgaacttcataaatatggaataaatgtctatttggacgct
gtgcttaatcataagggaggtgctgacgaaacagaaagatttttggcaatagaagtggat
cctgaaaacagaaatgaagaaatttcagaaccaaaagagattgaagggtggacaaaattt
acttttcctggaagaaataagaaatattctgaatttgaatggaaccatgctctttttagc
ggagttgactatgataatttaacaggaaaaactgcaatttataaaattgctggagaaaat
aaaggatgggcagaaaatgtggattctgaacttggaaattatgactatcttatgaatgcc
gatgtggattattcgcatcctgaagtgagaaatgaaattataaactgggggaaatgggtt
gtaaacgaattaaatctcgatggattcagaatggatgctgtaaaacatataagcgaagat
tttatcaaagaatttttaattgaagtaagaaaagtttatggagaaaaattttattctgtt
ggagaatattggaaaggtgacttggatactttaaaaacttatttggaaaatataggatac
gaaactgatttatttgatgtgggacttcattttaatttccacgaagcttcagtagaaaaa
gaaaactatgatttaacaacaatactggataattcaataatgcttatggatccaattaaa
gcggtaacatttgtggataatcacgattcgcaaaagggaagtgcactggaatctgaaata
gaaagctggtttattccacatgcctatgcgataatattgctttctgaaaaaggttatccg
tgcttgttctatggagattattacggtgtaggagataataaaagtccgcatggatgggta
atagataaacttctttatgtgagaagaaataacgcttatggagaacagataaattatttt
gatgatccaaatataatagctttttacagaaaaggtagggaaaatgaaataaatacagga
tgtgtagctattttatccaataatgaagatggagaaaaagctattgaaattggaaaagat
agaataggacaagtttgggaagaagttacaggaagcggatttgaagacgtggcaattgat
gaagaaggaaatgccgcatttagagtcgaaggtcaaaaaattgcagtttgggtacctaaa
aaacaatag

DBGET integrated database retrieval system