KEGG   Legionella endosymbiont of Polyplax serrata: CCU22_00280Help
Entry
CCU22_00280       CDS       T05191                                 

Gene name
fabF
Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
les  Legionella endosymbiont of Polyplax serrata
Pathway
les00061  Fatty acid biosynthesis
les00780  Biotin metabolism
les01100  Metabolic pathways
les01212  Fatty acid metabolism
Module
les_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:les00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CCU22_00280 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CCU22_00280 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:les01004]
    CCU22_00280 (fabF)
Enzymes [BR:les01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     CCU22_00280 (fabF)
Lipid biosynthesis proteins [BR:les01004]
 Fatty acid synthase
  Component type
   CCU22_00280 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ATW01675
UniProt: A0A2D3R7K6
LinkDB All DBs
Position
complement(57207..58445)
Genome map
AA seq 412 aa AA seqDB search
MNKRRVVVTGIGMVTPIGLNVCQTWNNILLGKSGVSLVNEFDTSKYTTKIWAKVKNFNIE
NYIPLSESKKMDLFTQFGMVATIEAIKDSKLIINDSISYRTGVSVGAGIGGIETIIRNQE
KLIKYGPKKISPFFIPSGIINILSGQISIKYKLKGPNIAISTACTTGTHNIGIAFRMISY
GDADLMICGGSEMTTNPLCLAGFSATRSLSKRNHEPEKASRPWDKDRDGFVIGEGSGILI
LEEFNHAINRGASIYAEIVGFGMSGDAYHITAPDKEAEGFLRSMLHAIKDAKVNIEQIDY
INAHGTSTYLNDLYETKAIKKLFKNHAYNLAISSTKSMTGHLLGATGAVEAIFTVLAIKN
QIAPPTINLDHPDKNCDLNYVAHKPQKRTINFALSNSFGFGGTNGSLLFKKI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaagacgtgttgttgtaacaggaataggaatggtaacacctattggattaaat
gtttgtcaaacatggaataatattttattggggaaaagtggtgtatcattggtgaatgag
tttgatacatctaaatatacaactaaaatttgggctaaagttaaaaactttaatattgaa
aattatattccattaagtgaatcaaaaaaaatggatttatttacacaatttggtatggtt
gctactattgaagctataaaagattctaagttaattattaatgattcgattagttatcgt
acaggagtttctgttggagcagggattggtggtatagaaactattataagaaatcaagaa
aaattaattaaatatggtccaaaaaaaatatctcctttttttattccttctggaataata
aatattttatctggacagatatcaataaaatataaattaaaaggaccaaatattgcaata
tctactgcttgtacaacaggaactcataatataggaattgcatttcgtatgatttcctat
ggagatgcagatcttatgatttgtggaggatctgagatgactacaaatccattatgttta
gctggtttttctgcaactcgttctttatcaaagcgcaatcatgaacctgaaaaagcatct
aggccatgggataaagatagagatggtttcgttatcggagaaggatctggaattcttata
ttagaagaatttaatcatgcaataaatagaggtgcatctatttatgcagaaatagttgga
tttggaatgtcaggagatgcttatcatattacagctcctgataaagaagcagagggattt
ttaagatcaatgctacatgctattaaagatgcaaaagtaaatatagaacaaattgattat
ataaatgctcacggaacttctacttatttaaatgatttgtatgaaacaaaagctataaaa
aaattatttaaaaatcatgcttacaacttagctattagctctacaaagtctatgactgga
catttattaggtgctacaggagctgtagaagctatttttactgttcttgcaattaaaaat
caaattgctcctcctactataaatttagatcatcctgataaaaattgtgatttaaattat
gtagcacataaacctcaaaaaagaactattaattttgctttaagtaattcatttggattt
ggaggtaccaatgggagtcttttatttaaaaaaatttaa

DBGET integrated database retrieval system