KEGG   Leptolyngbya sp. O-77: O77CONTIG1_01322Help
Entry
O77CONTIG1_01322  CDS       T04251                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
let  Leptolyngbya sp. O-77
Pathway
let00630  Glyoxylate and dicarboxylate metabolism
let00710  Carbon fixation in photosynthetic organisms
let01100  Metabolic pathways
let01120  Microbial metabolism in diverse environments
let01200  Carbon metabolism
Module
let_M00165  Reductive pentose phosphate cycle (Calvin cycle)
let_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
let_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:let00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    O77CONTIG1_01322 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    O77CONTIG1_01322 (cbbL)
Enzymes [BR:let01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     O77CONTIG1_01322 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAU41512
UniProt: A0A110AVD6
LinkDB All DBs
Position
1468075..1469505
Genome map
AA seq 476 aa AA seqDB search
MSYSQTKTQAKAGYQAGVKDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVRGEDNQFIAYIAYPLDLFEEGSVTNMLTS
IVGNVFGFKALKALRLEDLRIPVAYLKTFQGPPHGIQVERDKINKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFTFVAEAIHKAQAETGEIKGHY
LNVTAATCEEMLKRAEYAKELNMPIIMHDFLTAGFTANTTLSKWCRDNGVLLHIHRAMHA
VIDRQKNHGMHFRVLAKCLRMSGGDHIHTGTVVGKLEGDKAVTLGFVDLLRENYIERDPS
KGIYFTQDWASMPGVMAVASGGIHVWHMPALVEIFGDDAVLQFGGGTLGHPWGNAPGATA
NRVALEACLQARNEGRDLMREGGDIIREACRWSPELATACELWKEIKFEFEAVDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttattcgcaaaccaagacccaggcaaaagctgggtaccaggctggggttaaggac
taccgcctgacttactacacccccgactacacgcccaaagacacggacattctggccgcc
ttccgggtcacccctcagcccggtgtgccgcccgaagaagcgggtgcagccgttgcggct
gagtcctcgactggcacctggacgaccgtgtggactgacctgctaactgacctcgatcgc
tacaagggtcgttgctacgatatcgaacccgttcgcggtgaagacaatcagttcatcgcc
tacattgcctaccctctggatctgtttgaagaaggctctgttaccaacatgcttacctcc
attgtggggaacgtatttggtttcaaagctctgaaggccctgcgattggaagacttgcga
atccctgtagcctacctcaagactttccagggaccgccccacggcatccaggtcgagcgt
gacaagattaataagtacggtcgtcccctgctgggctgcaccatcaagcctaagctgggt
ctgtcggcaaagaactacggtcgtgcagtgtacgagtgtctgcgcggcggtctggacttc
accaaagacgacgaaaacatcaactctcagcccttccagcgctggcgcgatcgcttcacc
ttcgtcgctgaagctatccacaaggcacaagctgagactggtgaaatcaaggggcactac
ctcaatgtgaccgccgccacctgcgaagaaatgctgaagcgggctgagtatgcgaaagaa
ctcaatatgcccatcatcatgcatgacttcttgaccgcaggcttcacagctaacactact
ctctccaagtggtgccgcgataacggtgtcttgctgcatatccaccgtgccatgcacgct
gtgatcgaccgccagaagaatcacgggatgcacttccgcgtactggcaaaatgcttgcgg
atgtccggtggtgaccacatccacaccggaaccgtggtgggcaagctagaaggcgacaaa
gccgtgacgcttggctttgtggatctcttgcgtgaaaactacatcgagcgtgacccctca
aagggcatctacttcacccaggactgggcctccatgccgggtgtgatggcagttgcttct
ggcgggattcacgtctggcatatgcccgcgctggtggaaatcttcggcgacgatgccgtg
cttcagtttggcggcggcacgctgggtcacccctggggcaacgcacctggtgcaacggca
aaccgtgttgctctggaagcctgcttacaagctcgcaacgaaggtcgcgacctgatgcgc
gaaggcggcgacatcatccgcgaagcttgccgctggtcgcccgaactggctaccgcttgc
gaactgtggaaggaaatcaagttcgagtttgaggcggtggataccgtctga

DBGET integrated database retrieval system