KEGG   Leptolyngbya sp. O-77: O77CONTIG1_01324Help
Entry
O77CONTIG1_01324  CDS       T04251                                 

Gene name
cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
let  Leptolyngbya sp. O-77
Pathway
let00630  Glyoxylate and dicarboxylate metabolism
let00710  Carbon fixation in photosynthetic organisms
let01100  Metabolic pathways
let01120  Microbial metabolism in diverse environments
let01200  Carbon metabolism
Module
let_M00165  Reductive pentose phosphate cycle (Calvin cycle)
let_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
let_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:let00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    O77CONTIG1_01324 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    O77CONTIG1_01324 (cbbS)
Enzymes [BR:let01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     O77CONTIG1_01324 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAU41514
UniProt: A0A110AVE5
LinkDB All DBs
Position
1470051..1470407
Genome map
AA seq 118 aa AA seqDB search
MKTLPKERRYETFSYLPPLTDAQIARQIQYTLDQGYFPCIEFNEDSAAEMHYWTMWKLPL
FNATSPQEVLNEVQQCRSEFPNCYIRVVAFDNIKQCQVMSFIVHKPGNNNNYGGGYRY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttacccaaagagcgccgttacgaaaccttttcctatctgcctccgttgacc
gacgcacaaattgcccgtcagatccagtacacgctcgaccagggttatttcccttgcatc
gagtttaatgaagattctgcggctgagatgcactattggacgatgtggaagctgccattg
tttaatgcgacttctcctcaagaggtgctgaatgaggtgcagcaatgccgttcagaattc
ccgaactgctatatccgggtggttgcgtttgacaatatcaagcagtgccaggtgatgagc
ttcattgttcataagcctggtaacaacaacaactacggcggtggctatcgctactaa

DBGET integrated database retrieval system