KEGG   Leptolyngbya sp. O-77: O77CONTIG1_01326Help
Entry
O77CONTIG1_01326  CDS       T04251                                 

Gene name
arnC_1
Definition
(GenBank) Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
let  Leptolyngbya sp. O-77
Pathway
let01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:let00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:let01003]
    O77CONTIG1_01326 (arnC_1)
Enzymes [BR:let01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     O77CONTIG1_01326 (arnC_1)
Glycosyltransferases [BR:let01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   O77CONTIG1_01326 (arnC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_transf_21 Glyco_trans_2_3 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: BAU41516
UniProt: A0A0X8WS15
LinkDB All DBs
Position
complement(1471414..1472634)
Genome map
AA seq 406 aa AA seqDB search
MSDLNLAPSQAELAGWLGAIALVLLVVQIPALALLLTRLLSAARRASPLRPQNATPAMLG
TVSVIIPTLNEAHRLQPCLDGLTRQGYELREAIVVDSHSQDGTVDLVKAAAQRDPRFRVV
YDDPLPADWVGRPWALHTGFLHSSPQSDWVLGIDADTQPQPGLIPALLHAAQEQGYDLIT
LAPQFILKQPGEWWLQPALLMTLIYRFGAAGSPADGPERTMANGQCCLIRRSLLESLDGY
TSARQSFCDDVTLVREAARRGAKVGFLDGSSVLKVRMYEGIGETWREWGRSLDLKDASTP
AQTWSDVAFLLVVQALPWLLVPTVLTILAIRPTAASPTFLALLALNLCLLLLRLGTQFGI
RTAYDRPGSRFPLAFWLSPLADPLAALRILRSASRKPTQWRGRRYE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgatctgaacctggcaccgtcgcaagctgaactggcgggctggctgggggcgatc
gccctcgtgcttctcgtggttcagattccagccttggcgctgctgctgacccgtctgctc
agcgctgcccgtcgcgcttccccgctgcgtccccagaacgccacgcctgccatgctggga
accgtcagcgtcatcattcccacactgaatgaagcacatcgcctccagccttgcctcgac
gggctgacgcgccagggctatgagctgcgagaggcgatcgtcgtcgatagccattctcag
gacggcacagtggatttggtgaaagcggcggctcagcgagacccgcgatttcgcgtcgtg
tatgacgatccgctgcctgcggattgggtcggtcgcccctgggcgctgcacaccggattt
ctccacagtagccctcagagcgactgggttctcggcatcgatgccgacacgcagccgcag
ccagggctgattcctgctctgcttcacgccgctcaggaacagggctacgacctgattact
ctcgcgccacaatttatcctgaagcagcctggggagtggtggctgcaacccgcgctgctg
atgacgctgatctatcggtttggggcggcgggaagtccagcagacgggcctgagcgcacg
atggcgaatggtcagtgttgcctgattcggcgatcgctcctggaatccctcgacggctac
accagcgcccgccagtccttttgtgatgatgtgacgctggtgcgcgaggcagcacgacgc
ggcgcaaaggttgggtttctcgacggctccagtgtgctaaaagtccgtatgtacgagggt
ataggcgaaacctggcgcgaatgggggcgatcgctcgacctcaaagatgccagcaccccc
gcccaaacctggagcgacgtggcatttttgcttgtggtgcaggcgctgccctggctgctg
gttccgactgtgctaacgattctggctatccgtcccaccgctgcctcaccaacgttcctc
gcactgctggcactcaacctctgtttgctcctgctgcgcctcggcacccagttcggcatc
cgcaccgcctacgatcgccccggcagccgtttcccccttgccttttggctttcgcccctc
gccgatccgctggctgccctccgcatcctccgctctgccagccgcaaacccacacaatgg
cgcggccgacggtacgagtga

DBGET integrated database retrieval system