KEGG   Leptolyngbya sp. O-77: O77CONTIG1_01754Help
Entry
O77CONTIG1_01754  CDS       T04251                                 

Gene name
stkP
Definition
(GenBank) Serine/threonine-protein kinase StkP
Organism
let  Leptolyngbya sp. O-77
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-ProteinID: BAU41936
UniProt: A0A0X8WSW9
LinkDB All DBs
Position
complement(1955605..1957593)
Genome map
AA seq 662 aa AA seqDB search
MASFSKREQQRSRYRQLGLIGQGQFGRVFCAVHRQTGQLVALKNLERERFPTHKFLRELR
FLLTLQHENIVTCQALEHTATGRYLVMDYCEGGTLRSLLGEDHRLHPAQSLKLVADMLAG
LEHAHSQGIVHCDIKPENILLSVERWGWTARISDFGIARLRQELAESPSGGGNTGSPAYM
APERFYGQYSPAADLYSVGILLFELLAGYRPFSGTPTELMSAHLNRPLVLPDSIPAVFHP
LLSKALQKLAARRFQKAGEMWRSLVQAATDYGLGNLNWEGRFPQGSLRESRSMMISPALP
TVSPVKPLNPLPWRSRSVVTLEQPTTALAIAPRRGMPLFQPFPEIVEIYRASGDHVTFQS
HLTETQPSATVAASPLVSVQLPQPIRALQVRPQGCFAIAAQAVYLLDAPPGDVNQPWRSE
TIAEAGSECLVAIEAAGRWLAIAASPVEDGVGFLTLRPLPDRATLPDRATLVVKDSASLW
TAPNPIPLPVPTDCRRQLLYLAALDGRHLVLVSQILRGEKYLETWLEVFNRRGDRLGCLT
LPVRLGCIISAPDPYRLVACDADDPNALLIIDLKPFRVARLGVEIAPALLAAANWGYVLA
SAAGDLLLLDDLGQPVGRFQGPAAPVAIALFATTGILLATQTEAQSQLHLLNLKEMDTDL
ML
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcttttccaaaagagagcagcagcgctctagatatcgccagttagggctgatt
gggcaggggcaattcggtcgggtgttttgcgcggtgcatcggcaaacggggcaactggtt
gccctcaaaaacctggagcgagagcgcttcccgacccataagtttctgcgcgaactgcgc
tttttgctgacgcttcagcacgaaaacatcgtcacctgtcaggcattggaacacaccgcc
acagggcgctatctggtgatggactattgcgaaggcggcacgctccgcagcttgctgggt
gaagaccatcggctgcatccggctcaaagcttgaaactggtggcggatatgctggcgggg
ctggaacacgcccacagccagggcattgtgcattgcgacatcaagcccgaaaatatcttg
cttagcgtcgagcggtggggctggacggctcgcatttcagactttggcattgcgcggctg
cgacaggaactggcagagtcgccatcaggtggcggcaacacagggtcgcccgcttacatg
gctccggagcgattttacggacaatattcccctgcggcagatctctattccgtcggcatt
ttgctgtttgaactgctggcgggctatcgtccattttcaggcacgccgacggagctaatg
tcagcccatctgaatcggccgctggtgctgccggactcaattcctgctgtctttcatccg
ctgctgtcgaaagcgctgcaaaagctggcagcaaggcggtttcagaaggcgggcgagatg
tggcgatcgctcgtgcaggctgccactgactatgggttaggcaatctcaactgggagggg
cgattcccgcagggatcgcttcgcgaatcgcgctcgatgatgatttctcctgcactgccc
accgtttcccccgtcaagcccctaaaccccctgccgtggcgatcgcgctccgttgtgact
ctggagcagccgaccaccgcgctggcgatcgcccctcgtcgggggatgcccctcttccag
cctttcccagaaatcgtagaaatctatagggccagcggcgatcacgtcaccttccagtcc
caccttaccgagactcagcccagcgccacagtagcggctagtccactggtttctgtgcaa
ctgccccagcccattcgagcgttgcaggtgcggccgcagggctgtttcgcaattgcggct
caggcggtttacctcctggacgcgccgcctggggatgtcaatcagccctggaggagtgaa
actattgctgaggcaggatcagagtgtctggtggcgatcgaggcggcgggtcgctggctg
gcgatcgccgcttctccagtagaggacggggtcgggtttctcacgctgcggccgctgccc
gatagagccactttacccgatagagccactttagtagtaaaggattcagcctctttgtgg
actgcaccaaatcctattccgctgccagttcctacagattgtcgtcggcaattgctgtat
ctggcagcgctggatgggcggcatctggtgctggtgtcgcagattttgagaggcgagaag
taccttgaaacctggctagaagtgtttaaccgacggggcgatcgcctgggctgcctgacg
ctacctgtgcgtttaggctgcatcatctctgcccccgacccctatcgtctggtggcctgc
gacgcagacgaccccaacgccttactcatcatcgacctgaagccgtttcgcgtggcgcgg
ttgggcgtggaaattgcgcccgcgctgcttgctgccgcaaactggggctatgtgctggct
agcgccgcgggcgatttgctgctgctagatgacttggggcagcccgttggacggtttcaa
gggcccgctgcacccgtggcgatcgccctgttcgccaccacggggatcctgctggcaact
cagaccgaagcccaatcccaacttcaccttttgaacctgaaggaaatggacactgacctg
atgctctga

DBGET integrated database retrieval system