KEGG   Leptolyngbya sp. O-77: O77CONTIG1_02166Help
Entry
O77CONTIG1_02166  CDS       T04251                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
let  Leptolyngbya sp. O-77
Pathway
let00010  Glycolysis / Gluconeogenesis
let00020  Citrate cycle (TCA cycle)
let00620  Pyruvate metabolism
let01100  Metabolic pathways
let01110  Biosynthesis of secondary metabolites
let01120  Microbial metabolism in diverse environments
let01130  Biosynthesis of antibiotics
let01200  Carbon metabolism
Module
let_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:let00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O77CONTIG1_02166 (pdhC)
   00020 Citrate cycle (TCA cycle)
    O77CONTIG1_02166 (pdhC)
   00620 Pyruvate metabolism
    O77CONTIG1_02166 (pdhC)
Enzymes [BR:let01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     O77CONTIG1_02166 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase DEC-1_N
Motif
Other DBs
NCBI-ProteinID: BAU42345
UniProt: A0A0X8WVA7
LinkDB All DBs
Position
2402381..2403697
Genome map
AA seq 438 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWVKAPGDKIEKGETVVVVESDKADMDVESFYEGYLATII
VDAGSTAPVGEAIALIAETEAEIEAAKQKAASASAPAPAAPTPAPATTEPEPVAATVEEA
IASSNGSSGRLVVSPRARKLAKELKVDLATLKGSGPHGRIVAEDVEAAVGKVSEPATAAV
TPAAAAVAAPVTAPAPAPAPATPKPAPAPAAPVTPGQVVPLTTLQNAVVRNMVASLEVPT
FHVGYTITTDNLDKLYKQIKSKGVTMTALLAKAVAVTLKKHPLLYAAYTDQGIKYNSGIN
VAVAVAMDDGGLITPVLQAADQMDIYTLSRTWKDLVDRARSKQLQPAEYSTGTFTLSNLG
MFGVDRFDAILPPGQGAILAIGASRPQVVATAEGLFGVRTQMQVNLTADHRIIYGAHAAA
FLQDLAKLIETDAQSLTL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaagttttcatgcctgcgctcagttctacgatgaccgagggaaagattgtt
tcctgggtaaaagcaccgggcgacaagattgaaaagggcgaaaccgtggtggtggtggag
tccgacaaggcggacatggatgtggagtcgttctatgagggttatctagcaacgattatt
gtggacgcaggcagcacggctccagtgggcgaggcgatcgccctgattgccgaaaccgag
gcggagattgaggccgcgaagcagaaggcagccagtgcttcggctcctgctccggctgcc
ccgactcctgcgcctgctactaccgaaccggaacccgtcgctgcgaccgtggaagaggcg
atcgccagcagcaacggcagttctgggcggctcgtcgtgtcgccccgcgcccgcaagctg
gccaaagaactcaaggttgacctagccacgctcaaaggcagtggcccccacgggcgcatc
gttgccgaagatgtagaagccgccgttggcaaagtgtctgaacctgcaactgcggcagtg
actccggctgcggctgcggtcgctgctccggtgactgcgcctgctccggctccggctccg
gcaactcccaaacccgcccccgctccggcggcccccgtcacgccgggccaggtcgtgccc
ctgaccacgctgcaaaatgccgttgtgcggaacatggtcgccagcctagaggtgcccacc
ttccacgtcggctataccatcaccaccgacaacctggacaaactctacaagcagatcaag
tccaagggcgtaacgatgacggcactgctggccaaggcagttgccgtgaccctgaagaag
catccgctactctacgcggcctacaccgaccagggcattaagtacaacagcggcatcaat
gtggcggtggcggtggcgatggacgatggcggactgattacgcccgttctgcaagccgct
gaccaaatggatatctacaccctgtcgcgcacctggaaggacttggtcgatcgcgcccgc
tccaagcagctccagcccgcagaatacagcacaggcacgtttacgctctccaacctggga
atgtttggcgttgatcgctttgatgccatcctgccgccgggccagggcgcgattctggcg
attggcgcatcccgcccgcaggtagtggcgaccgcagaaggactattcggcgtgcggacg
caaatgcaggttaacctgactgccgatcaccggattatctacggtgcccatgccgcagcg
ttccttcaagacttggccaagctgatcgaaaccgacgcgcaatcgctgacgctgtaa

DBGET integrated database retrieval system