KEGG   Leptolyngbya sp. O-77: O77CONTIG1_02224Help
Entry
O77CONTIG1_02224  CDS       T04251                                 

Gene name
cpcE
Definition
(GenBank) Phycocyanobilin lyase subunit alpha
  KO
K02288  phycocyanobilin lyase subunit alpha [EC:4.4.1.32]
Organism
let  Leptolyngbya sp. O-77
Pathway
let00196  Photosynthesis - antenna proteins
let01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:let00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    O77CONTIG1_02224 (cpcE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:let00194]
    O77CONTIG1_02224 (cpcE)
Enzymes [BR:let01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.32  C-phycocyanin alpha-cysteine-84 phycocyanobilin lyase
     O77CONTIG1_02224 (cpcE)
Photosynthesis proteins [BR:let00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    O77CONTIG1_02224 (cpcE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEAT_2 HEAT_PBS HEAT_EZ NRIP1_repr_3
Motif
Other DBs
NCBI-ProteinID: BAU42403
UniProt: A0A0X8WUG8
LinkDB All DBs
Position
complement(2477817..2478665)
Genome map
AA seq 282 aa AA seqDB search
MLDGTSETQFEESTAVSEAAGAETLTVEQAIANLAHPDTSLRYYAAWWLGKFRVSDPAAV
DALIAALRDESDRTELGGYPLRRNAARALGKLGDRRAVPGLTECLGCEDFYVRESAAQSL
GMLGDSSCVPALLGLLAGGVAAAVKVPGRPHLAQPYEAILEALGALGAVEAVDVIRPFAE
HPIQRVQYSAVRALYQLTEEAAYGDRLVAALQSDDINLRRVALSDLGAVGYLPAAEAIAT
AATENSFKLFSLKGLLERAVRQSPDTLSADAIRVITLMDGML
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacggaacatcggagacgcagtttgaggaatcgaccgctgtatcggaagccgct
ggcgcagaaacgctgacggtggagcaggcgatcgccaatcttgctcaccccgacaccagc
ctgcgctattacgcggcctggtggttggggaaatttcgcgtgtctgatccggcggccgtg
gatgcgctgattgcagcgctgcgcgacgagtctgaccggacggaactgggcggctatccg
ctgcggcggaatgcggcccgggcgctgggcaagctgggcgatcgccgtgccgttccgggg
ttgaccgagtgccttggctgtgaagacttctacgtgcgcgagtcagcggcacaatcgcta
gggatgctgggcgattcgtcctgcgtgcccgcgctgttggggctgctggcgggcggcgtg
gcggccgcggtgaaggtgccggggcggccccatctggcgcagccctacgaagccatcctg
gaagcgctgggtgcgctgggtgctgtggaagcggttgatgtgattcgaccgtttgcggag
catccgattcagcgtgtgcaatattccgctgtgcgggcgctgtaccagcttacagaagag
gccgcctatggcgatcgcctggtggccgcgctgcaaagcgatgacattaacctgcgccgc
gtcgccctgtctgacctgggcgctgtgggctatctccccgccgccgaggcgatcgccacc
gccgccaccgaaaatagcttcaagctcttttccctcaaaggattgctagaacgcgccgtc
cgtcagtcgcccgataccctcagcgccgatgctattcgggtaataacgctgatggacggg
atgctgtag

DBGET integrated database retrieval system