KEGG   Leptolyngbya sp. O-77: O77CONTIG1_04119Help
Entry
O77CONTIG1_04119  CDS       T04251                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
let  Leptolyngbya sp. O-77
Pathway
let00473  D-Alanine metabolism
let00550  Peptidoglycan biosynthesis
let01100  Metabolic pathways
let01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:let00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    O77CONTIG1_04119 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O77CONTIG1_04119 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    O77CONTIG1_04119 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:let01011]
    O77CONTIG1_04119 (ddl)
Enzymes [BR:let01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     O77CONTIG1_04119 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:let01011]
 Precursor biosynthesis
  Amino acid ligase
   O77CONTIG1_04119 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAU44280
UniProt: A0A0X8WZ81
LinkDB All DBs
Position
complement(4615160..4616269)
Genome map
AA seq 369 aa AA seqDB search
MAKLRVGLLFGGCSGEHEVSIRSAQAIARGLSDPANADRYELAPVYIQKDGRWLAGESAI
HVLSAGVPLELGSSDAPADPSGETSALQVPTVAAVERWQSTAQVSGVDVWFPVLHGPNGE
DGTVQGMLTLMQAPFVGSGVLGSALGMDKIAMKMAFAQAGLPQVGYRVVRRSQVYSNPCV
FPKLCDEIEAELGYPCFVKPANLGSSVGIAKVRTRAQLEAALDSAASYDRRLIVEAAAPS
PRELECAVLGNDHPQASVVGEITYSSDFYDYETKYTEGLADLHIPANLPAAIARQIQDMS
ICAFEAVDAAGLARVDFFYCESTGEVFINEINTMPGFTATSMYPMLWAASGVPFPELVDR
LVKLALEER
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttgcgggtggggctgctgtttggtgggtgttcgggagaacatgaggtatcg
attcgctcggcacaggcgatcgcccgtggcttgagcgaccctgccaacgcagaccgctac
gaacttgcgcccgtgtatatccagaaagacggccgctggctggcgggagagtctgctatt
cacgttctatcggcgggagtgccgctggaattgggcagttcggatgctccggcagacccg
tcgggcgaaaccagcgccctgcaagtgccaacggtggcggcggtagaacgctggcaatcg
accgcgcaggtcagcggcgtggacgtgtggttcccggtgttgcacgggcccaacggcgaa
gacggcacggtgcagggaatgctgacgctgatgcaggctccgtttgtggggtcgggggtg
ctggggtcggcactggggatggacaagatcgctatgaaaatggcgtttgcccaggcgggg
ctgccccaggtgggctatagggtggtgcggcgatcgcaggtctattccaatccctgtgtt
ttccctaagctgtgcgacgagattgaagccgaactgggctatccctgctttgtcaagccc
gctaacctggggtcctccgtcggcattgccaaagtccgcacccgcgcccagctcgaagct
gccctcgacagcgccgccagctacgatcgccgcctgattgtggaagcggccgcgccctca
ccccgtgaactggagtgcgctgtgctgggcaatgaccatcctcaggcatcggtcgtgggc
gagatcacctacagcagcgacttttacgactacgagacgaaatacaccgaaggtctggcc
gacctgcatatcccggcaaacttgccagcggcgatcgcccgccagatccaggatatgtcg
atttgcgcctttgaagccgtagacgcagccggtctggcccgcgtggactttttctattgc
gagtctacaggcgaggtcttcatcaatgaaatcaacaccatgcccggtttcaccgccacc
agcatgtatcccatgctgtgggctgccagcggggtgcccttcccagaactggttgatcgg
ctggtgaagctggcgctagaggagcgatag

DBGET integrated database retrieval system