KEGG   Leucobacter sp. DSM 101948: Leucomu_06840Help
Entry
Leucomu_06840     CDS       T05802                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
leu  Leucobacter sp. DSM 101948
Pathway
leu00473  D-Alanine metabolism
leu00550  Peptidoglycan biosynthesis
leu01100  Metabolic pathways
leu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:leu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Leucomu_06840
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Leucomu_06840
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Leucomu_06840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:leu01011]
    Leucomu_06840
Enzymes [BR:leu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Leucomu_06840
Peptidoglycan biosynthesis and degradation proteins [BR:leu01011]
 Precursor biosynthesis
  Amino acid ligase
   Leucomu_06840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: QAB17674
UniProt: A0A410H9N8
LinkDB All DBs
Position
1451112..1452272
Genome map
AA seq 386 aa AA seqDB search
MTAASSSSPSERRADAPGAGEKRTVALLFGGRSSEHGISCVTAAGVLRAIDRAKFDVIPV
GITKQGATVLMREEDLEGYRLEPGALPEVGDNGTRVLWPASTATRTLTVVDQAGALRSLG
HVDAVLPMLHGPYGEDGTVQGMLDLVDLPYVGSGVLGSALCMDKHAVKTVLADAGIPVAP
WRTVTREQLSRDPYLSERLDEGLSYPLFVKPARAGSSVGVSRVAELAELPAALEVAFAED
RTVLIESGVTGREVEIAVLEGRGEDRPRTSSVIGEIVFTGRDFYDFEAKYLGAAGVELAL
PAQVTELEFEAIRDAAVRAFEVTQCAGLARIDFFLTDEGPVLNEINTLPGFTPISMYPRL
WQESGLEYTDLITELVELAIEKKPAY
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcagcatcctcatcctccccgtcggagcgccgcgccgacgcgcccggcgcgggc
gagaagcgcacggtcgcgctgctcttcggcggccgctccagcgagcacggcatcagctgc
gtcaccgccgcgggcgtgctgcgcgcgatcgaccgcgcgaagttcgacgtgatcccggtg
ggcatcacgaagcagggggccaccgtgctcatgcgggaggaagacctcgaggggtaccgg
ctcgagcccggcgcgctgcccgaggtcggcgacaacggcacgcgcgtgctgtggccggcc
tccaccgcgacccgcacgctcaccgtcgtcgatcaggcgggcgcgctgcgatcgctgggg
cacgtcgacgcggtgctgcccatgctgcacggcccgtacggcgaagacggcaccgtgcag
ggcatgctcgacctggtcgacctgccctatgtgggcagcggcgtcctgggctcggcgctc
tgcatggacaagcacgcggtcaagaccgtgctggccgacgccggcatcccggtggcgccc
tggcgcacggtgacgcgcgagcagctctctcgcgacccgtacctctcggagcgtctcgac
gaggggctctcctacccgctgttcgtgaagccggcccgggccggctcgtcggtgggggtg
agccgggtcgccgagctcgccgagctgcccgccgcgctcgaggtggcgttcgcagaggat
cgcacggtgctcatcgagtcgggcgtgacggggcgcgaggtggagatcgcagtgctcgag
ggtcgcggcgaggatcgcccgcgcaccagctcggtgatcggcgagatcgtgttcaccggg
cgcgacttctacgatttcgaggcgaagtatctcggggccgcgggcgtcgagctcgcgctg
ccggcgcaggtcacggagctcgagttcgaggcgatccgggacgccgcggtgcgcgccttc
gaggtgacgcagtgcgccgggctcgcgcgcatcgacttcttcctcaccgacgagggaccg
gtgctcaacgagatcaacacgctgcccggcttcaccccgatctcgatgtacccgcggctc
tggcaggagtcggggctcgaatacaccgacctcatcaccgagctggtcgagctggcgatc
gagaagaagcccgcctactga

DBGET integrated database retrieval system