KEGG   Leucobacter sp. DSM 101948: Leucomu_06860Help
Entry
Leucomu_06860     CDS       T05802                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
leu  Leucobacter sp. DSM 101948
Pathway
leu00250  Alanine, aspartate and glutamate metabolism
leu00280  Valine, leucine and isoleucine degradation
leu00310  Lysine degradation
leu00410  beta-Alanine metabolism
leu00640  Propanoate metabolism
leu00650  Butanoate metabolism
leu01100  Metabolic pathways
leu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:leu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Leucomu_06860 (gabT)
   00650 Butanoate metabolism
    Leucomu_06860 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Leucomu_06860 (gabT)
   00280 Valine, leucine and isoleucine degradation
    Leucomu_06860 (gabT)
   00310 Lysine degradation
    Leucomu_06860 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Leucomu_06860 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:leu01007]
    Leucomu_06860 (gabT)
Enzymes [BR:leu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Leucomu_06860 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Leucomu_06860 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     Leucomu_06860 (gabT)
Amino acid related enzymes [BR:leu01007]
 Aminotransferase (transaminase)
  Class III
   Leucomu_06860 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QAB17677
UniProt: A0A410H9R8
LinkDB All DBs
Position
1455769..1457112
Genome map
AA seq 447 aa AA seqDB search
MADASIIGGPSLPQERKLVTSIPGPKSQEIIARKSAAVAAGVGAALPVSIVAAGGGVMVD
VDGNSLIDLGSGIAVTGVGNSAPAVVKAVTEQVQQFTHTCFTVTPYEGYVQVAEKLNELT
PGDHEKRSALFNSGAEAVENAIKIARHYTKKNGVVVFDHAYHGRTNLTMGMTAKNMPYKD
GFGPFAPEVYRVATSYPFRDGLTGAEAAEVALTQIEKQVGASNLAAIIIEPIQGEGGFIA
PAEGFLPALQEWATANGVVFILDEVQTGFARTGDLFAANHEGVVPDLVTTAKGIAGGLPL
SAVTGRAEIMDSAHAGGLGGTYAGSPIACAAALATIETYEQENLSQRAREIGAIIEEFFA
ELQKNDDRIGDIRGRGAMQAVELVESGSKKPAAALTGAIAKQAGDQGVILLTCGTYGNVI
RFLPPLSISDELLREGLQVVADALAAN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgccagcatcatcggcggcccctcgctcccgcaggagcgcaagctcgtcacc
agcatccccggtccgaaatcgcaggagatcatcgcgcgcaagagcgccgcggtcgcggcc
ggcgtcggcgccgccctgcccgtgtcgatcgtcgcagccggtggcggcgtcatggtcgac
gtcgacggcaactcgctcatcgacctcggctccggcatcgccgtgaccggcgtcggcaac
tcggcccccgccgtggtgaaggccgtcaccgagcaggtgcagcagttcacccacacctgc
ttcaccgtcaccccctacgagggctacgtgcaggtcgccgagaagctcaacgagcttacc
cccggcgaccacgagaagcgctccgcactcttcaactcgggcgccgaggccgtcgagaac
gcgatcaagatcgcccgccactacaccaagaagaacggcgtcgtcgtcttcgaccacgcc
taccacggccgcaccaacctcaccatgggcatgaccgccaagaacatgccctacaaggac
ggcttcggcccgttcgcccccgaggtctaccgcgtcgcgacctcgtaccccttccgcgac
ggcctgaccggcgccgaggccgccgaggtcgcgctcacccagatcgagaagcaggtcggc
gcgtcgaacctcgccgccatcatcatcgagcccatccagggcgagggcggcttcatcgcc
cccgccgagggcttcctccccgccctgcaggagtgggcgaccgccaacggcgtcgtcttc
atcctcgacgaggtgcagaccggcttcgcccgcaccggcgacctcttcgccgcgaaccac
gagggcgtcgtgcccgacctggtcaccaccgccaagggcatcgccggcggtctgcccctg
tcggctgtcaccggccgcgccgagatcatggactcggcgcacgcgggcggcctcggcggc
acctacgcgggcagccccatcgcctgtgccgcggccctcgccaccatcgagacctacgag
caggagaacctctcgcagcgcgcccgcgagatcggcgcgatcatcgaagagttcttcgcc
gagctgcagaagaacgacgaccgcatcggcgacatccgcggacgcggcgccatgcaggcc
gtcgagctcgtcgagtcgggctcgaagaagcccgccgccgccctcaccggcgcgatcgcg
aagcaggccggcgaccagggcgtcatcctgctcacctgcggcacctacggcaacgtgatc
cgcttcctcccgccgctctccatctcggacgagctgctgcgcgagggcctccaggtcgtc
gccgacgcgctggccgccaactga

DBGET integrated database retrieval system