KEGG   Leucobacter sp. DSM 101948: Leucomu_07285Help
Entry
Leucomu_07285     CDS       T05802                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
leu  Leucobacter sp. DSM 101948
Pathway
leu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
leu01100  Metabolic pathways
leu01110  Biosynthesis of secondary metabolites
leu01130  Biosynthesis of antibiotics
leu01230  Biosynthesis of amino acids
Module
leu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:leu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Leucomu_07285
Enzymes [BR:leu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Leucomu_07285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA Cytidylate_kin AAA_18 Cytidylate_kin2 TsaE AAA_16 DUF1658 RuvB_N TIP49
Motif
Other DBs
NCBI-ProteinID: QAB17746
UniProt: A0A410HA51
LinkDB All DBs
Position
1551679..1552407
Genome map
AA seq 242 aa AA seqDB search
MNGHRRAGRDTGPPASKPKPAPPARPTPPNDGQQARDAAADQAAAARNAPAGSRGRSRRR
RRRRGGARLPDRAVVFVGPMAAGKTSLGKRVARELGVPFIDTDAVFVRQYGPITEFFERH
GEPEFRRLEAEVIAAELATGGGRIVALGGGAVLTESTRRLLAEHPVVLLMTTQEAVLRTA
NLSRRPLLRDDPEAWGRILEERRPLYEEVADVTYRTDRATKEQLARRVAQWARSFRKRSD
NA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggtcaccggcgagcggggcgcgacacggggccgcccgcgtcgaagcccaagccc
gctccgccagcgcggccgacgcctccgaacgacggtcagcaggcgcgcgacgccgcggcc
gaccaggctgctgccgctcgcaacgcgcccgcgggttcgcgcggccgttcacggcggcgg
cgccggcggcgcggcggcgcgcggctgcccgaccgggccgtggtgttcgtgggccccatg
gcggcgggcaagacgagtctcggcaagcgggtggcgcgcgagctcggtgtgccgttcatc
gacacggacgccgtgttcgtgcgccagtacggccccatcaccgagttcttcgagcggcac
ggcgagcccgagttcaggcggctcgaggccgaggtgatcgcagccgagctcgcgaccggc
ggcgggcgcatcgtggcgctcggaggcggggcggtgctcaccgagagcacgagacggctg
ctcgccgagcacccggtggtgctgctcatgaccacgcaggaggcggtgctgcgcaccgcg
aacctgtcgcgccggccgctgctgcgcgacgatcccgaggcgtgggggcgcattctcgag
gagcgccgcccgctgtacgaggaggtcgccgacgtgacctatcgcaccgaccgggccacc
aaggagcagctcgcgcgccgcgtggcgcagtgggctcgcagtttcaggaagaggagcgac
aacgcatga

DBGET integrated database retrieval system