KEGG   Leucobacter sp. DSM 101948: Leucomu_07905Help
Entry
Leucomu_07905     CDS       T05802                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
leu  Leucobacter sp. DSM 101948
Pathway
leu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:leu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Leucomu_07905
Enzymes [BR:leu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Leucomu_07905
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Leucomu_07905
    1.1.1.-  
     Leucomu_07905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc NAD_binding_3 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: QAB17848
UniProt: A0A410HA50
LinkDB All DBs
Position
1678649..1679704
Genome map
AA seq 351 aa AA seqDB search
MKAARFHGRKDIRIEEVPEPELRPGAVAIDVAWCGICGTDLHEYLDGPIFCPAPGHPHPL
SHEESPVTLGHEFSGTVSALGEGVADLAVGDSVVVEPYFVCDECGPCRAGNYHLCEKMGF
IGLAGGGGGLSEKIVVDRRWVHPIGDIPLDQAALIEPLSVAHHAVRRSDASAGDVALVGG
AGPIGLLVAAVLKAEGVTVIMSELSDARKAKARETGVADHVIDPSQEDLIARVREITGGF
GADVAFECTSVNAVLDQLFDAVKPTGVIVNVSIWGKPAQLDMQKLVLKEIDLRGTIAYVR
DHAATIKLVQEGKVDLEPFITGRIALDDLIDEGFDTLINRNETAVKIIVHP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcacgcttccacggacgcaaggacattcggatcgaggaggtaccggagccg
gagctgcggccgggcgccgtagccatcgacgtggcctggtgcggcatctgcggcaccgac
ctgcacgagtacctcgacggcccaatcttctgccccgcgccgggccatccgcacccgctg
tcgcacgaggagtcgcccgtcaccctcggtcacgagttctcgggcacggtgagcgccctc
ggcgaaggggtcgccgatctcgccgtcggagactcggtcgtggtcgagccgtacttcgtg
tgcgacgagtgcggcccctgccgggccggcaactaccacctgtgcgagaagatgggcttc
atcggcctcgcgggcggcgggggcggcctgagcgagaagatcgtggtggatcgccgctgg
gtgcacccgatcggcgacatcccgctcgaccaggcggcgctcatcgagccgctgtcggtc
gcgcaccacgcggttcgccgctcggacgcgagcgccggcgatgtcgcgctcgtgggcggc
gccggcccgatcgggctgctcgtggccgcggtgctcaaggccgagggtgtgaccgtcatc
atgagcgagctgagcgacgcccgcaaggcgaaggcgcgcgagaccggcgtggccgatcac
gtcatcgatccctcgcaagaggatctcatcgcccgcgtgcgcgagatcaccgggggcttc
ggcgccgacgtggcgttcgagtgcaccagcgtcaacgcggtgctcgatcagctgttcgac
gcggtgaagccgaccggcgtgatcgtgaacgtctcgatctggggcaagcccgcccagctc
gacatgcagaagctcgtgctcaaggagatcgacctgcgcggcacgatcgcgtacgtgcgc
gaccacgccgcgacgatcaaactcgtgcaggagggcaaggtggatctcgagccgttcatc
acgggccgcatcgccctcgacgacctgatcgacgagggtttcgacaccctcatcaatcgc
aacgagaccgcggtgaagatcatcgtgcacccgtag

DBGET integrated database retrieval system