KEGG   Lelliottia sp. WB101: DAI21_05995Help
Entry
DAI21_05995       CDS       T05398                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
lew  Lelliottia sp. WB101
Pathway
lew00250  Alanine, aspartate and glutamate metabolism
lew00410  beta-Alanine metabolism
lew00640  Propanoate metabolism
lew00650  Butanoate metabolism
lew01100  Metabolic pathways
lew01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DAI21_05995
   00650 Butanoate metabolism
    DAI21_05995
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DAI21_05995
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DAI21_05995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lew01007]
    DAI21_05995
Enzymes [BR:lew01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DAI21_05995
Amino acid related enzymes [BR:lew01007]
 Aminotransferase (transaminase)
  Class III
   DAI21_05995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVY97257
UniProt: A0A2S0PJ06
LinkDB All DBs
Position
1284671..1285936
Genome map
AA seq 421 aa AA seqDB search
MNNHELNERRLQATPRGIGVMCGFYADKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VIGAIEKQLQSFTHTAYQIVPYEGYIALAERINARVPIEGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQYPNTLHGVSSQ
DALKSLERIFKADIAPDQVAAIILEPVQGEGGFNVAPPDFMQGLRALCDTHGILLIADEV
QTGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAALAVLDVIDEEDLCARASHLGHHLVEVLSKAKSGCPYIADIRAQGSMVAVEFND
PETGQPSPEFTRKVQERALAEGLLLLSCGVYGNVIRFLYPLTIPDAQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatcacgagttaaatgaacggcgtttgcaggcaacgccgcgcggtatcggggtg
atgtgcggtttctacgccgataaagcggaaaacgccacgctgtgggatatcgaaggcaac
gaagtgatcgacttcgccgccgggattgcagtgctgaacacgggccatcgccatcccaaa
gtgatcggcgccatcgaaaagcagcttcagtcgtttacccacacggcgtaccagattgtg
ccgtacgaaggctatatcgccctcgcagagcgcatcaatgcccgcgtgccgattgaaggg
ccagccaaaaccgctttcttctcgacgggtgcagaagccgtcgaaaacgcggtcaaaatc
gcccgcgcctacaccaaacgacccggtcttatcacgttcggcggcgccttccacgggcgt
acctttatgaccatggccctcaccggcaaagtggcaccgtacaaactcggcttcggcccg
ttccctggctcggtctatcacgcgcaatatcccaacacgctgcacggcgtgagttctcag
gacgccctgaaaagcctggagcgtatctttaaagccgatatcgccccggatcaggtggca
gcgattatcctcgaaccggttcagggtgaaggcggattcaacgtcgcgccgcccgatttt
atgcaagggctgcgcgccctgtgcgacacccacggaattttgctgatcgctgacgaagtg
cagaccggctttgcccgtaccgggaaactgttctcgatggagcatcactgcgtcaaaccg
gatctgatcaccatggcgaaaagcctggcgggcggtatgccgctctcggcggtgtcgggc
cgtgccgaggtgatggacgcccccgcaccgggcgggctgggcggcacctacgccgggaac
ccgctggcgattgcggcggcactggcggtgctggacgtgatcgacgaagaggatctgtgc
gctcgcgcctcgcacctgggccatcatctggtggaagtgctgagcaaggccaaatctggt
tgcccgtatatcgccgatatccgcgcgcaaggctcgatggtggcggtggagttcaacgat
cccgagaccgggcagccctcaccggaatttacccgtaaggttcaggagcgcgcgctggcg
gaagggctgttgctgctcagctgcggcgtatacggcaacgtcattcgttttctctatcca
ctcaccattcccgacgcgcagttccgcaaagcgctggatatcatctctgcctcgctgact
cgataa

DBGET integrated database retrieval system