KEGG   Lelliottia sp. WB101: DAI21_06300Help
Entry
DAI21_06300       CDS       T05398                                 

Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
lew  Lelliottia sp. WB101
Pathway
lew00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lew01100  Metabolic pathways
lew01110  Biosynthesis of secondary metabolites
lew01130  Biosynthesis of antibiotics
lew01230  Biosynthesis of amino acids
Module
lew_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lew00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DAI21_06300
Enzymes [BR:lew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     DAI21_06300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA AAA_16 APS_kinase AAA_22 TsaE ABC_tran AAA_7 AAA_5 Ploopntkinase3 AAA_17 RNA_helicase His_biosynth AAA_PrkA AAA_25 AAA_28 AAA_29 RsgA_GTPase PduV-EutP Mg_chelatase AAA_24 IstB_IS21 AAA_14 GTP_EFTU MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AVY97312
LinkDB All DBs
Position
1355657..1356178
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVETPPREVLEALAGERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
gggcgccagttggctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagctgatgtgggctgggtcttcgatgtagaaggcgaagaaggtttccgt
gaccgtgaagaaaaagttatcaatgaacttacggaaaaacagggcatcgtgctggcaacg
ggcggtggttctgtaaaatctcgcgaaactcgtaaccgtctctccgcccgcggcgttgtg
gtctatcttgagacgaccatcgaaaaacagctggcacggacgcagcgcgataaaaagcgc
ccgttactgcaagttgaaacgcctccacgtgaagttctggaagcattggccggtgagcgc
aatccactgtacgaagagattgctgatgtaaccattcgtaccgacgatcagagcgctaaa
gtggttgcaaaccagattattcatatgctggaaagcaactga

DBGET integrated database retrieval system