KEGG   Lelliottia sp. WB101: DAI21_21940Help
Entry
DAI21_21940       CDS       T05398                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
lew  Lelliottia sp. WB101
Pathway
lew00730  Thiamine metabolism
lew00790  Folate biosynthesis
lew01100  Metabolic pathways
lew02020  Two-component system
Module
lew_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lew00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DAI21_21940
   00790 Folate biosynthesis
    DAI21_21940
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DAI21_21940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lew04147]
    DAI21_21940
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lew00537]
    DAI21_21940
Enzymes [BR:lew01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DAI21_21940
Exosome [BR:lew04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DAI21_21940
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lew00537]
 Enzymes
  DAI21_21940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Sulfatase PT-VENN
Motif
Other DBs
NCBI-ProteinID: AVZ00122
UniProt: A0A2U3TI54
LinkDB All DBs
Position
complement(4529222..4530637)
Genome map
AA seq 471 aa AA seqDB search
MKQSALFIALLPLLFTPAIYADTTNTQVLDNRAAQGDITQPGGARRLSEDQTEALRASLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHEKDHQTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCPTNALEKGGKGSITEQLLNVRADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLAAITEAGQDKPLLGLFSDGNMPVRWEGPKASYHGN
IDKPAVTCTPNPKRDDSVPTLAQMTDKAIALLSKGEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALAFAKKDGNTLVVVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEGDSMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacagagcgcacttttcatcgcattactgcctttattatttacccctgccatttat
gccgacactacgaatacccaggtgctggataatcgcgcggctcagggagatatcacgcag
ccgggcggcgcacgccgtctgtcagaagatcaaaccgaagcgctgcgtgcatcgctaaat
gataaaccggctaaaaatattattttgctgattggtgatgggatgggcgattccgaaatc
accgcagcgcgaaattatgccgaaggggccggcggcttttttaaaggtattgacgcattg
ccgttgaccggacaatacacccactacgcgctggataaaaaaaccggtaagcctgattac
gtgaccgactcggcggcctccgccacggcgtggaccacgggcgtaaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaggatcaccagaccattctggagatggcgaaggcg
gctggccttgcgacaggtaacgtctcaacggctgaactgcaggatgcaacgcctgcggcg
ctggtggcgcatgtgacgtcgcgtaaatgctacggcccgtccgtgaccagcgaaaaatgc
ccgaccaatgcgctggaaaagggtggcaaaggctccatcaccgaacagctgctgaatgtc
cgcgccgatgtgacgctgggcggtggggcgaaaacgttcgcggaaaccgcgacggccggg
gagtggcagggcaaaactcttcgtgaacaggcgcaggcgcggggttatcagctggtgagc
gatgccgcttcactggcggcgatcaccgaagcgggccaggacaagccgctgctcggcctg
ttctcagacggcaacatgccggtgcgctgggaagggccaaaagcctcttaccacggcaac
atcgacaaaccggcggtgacctgcacgccaaacccgaaacgcgatgacagcgttccgacg
ctggcacagatgaccgacaaagccatcgctttgctgagcaagggggagaagggcttcttc
ctgcaggttgaaggcgcgtcgattgataaacaggatcatgcggcaaatccgtgcggtcag
attggcgaaaccgtcgatcttgatgaagccgtgcagaaagcgctggcgttcgcgaagaaa
gatggcaacaccctcgtggtagtgaccgctgaccatgcgcacgccagccagatcgtggca
cccgataccaaagcgcctggcctgactcaggcgctgaacaccaaagacggtgcggtaatg
gtgatgagctatggcaactccgaaggcgattccatggaacataccggcacacagctgcgc
atcgcggcgtatggcccgcacgcggcaaatgtggtcgggctgacggatcaaacggatctg
ttctacaccatgaaagccgctcttggcctgaaataa

DBGET integrated database retrieval system