KEGG   Lysobacter enzymogenes C3: GLE_0815Help
Entry
GLE_0815          CDS       T04371                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lez  Lysobacter enzymogenes C3
Pathway
lez00564  Glycerophospholipid metabolism
lez01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lez00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GLE_0815
Enzymes [BR:lez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GLE_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 FAD_binding_3 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ALN56173
UniProt: A0A0S2DCT2
LinkDB All DBs
Position
complement(891533..893038)
Genome map
AA seq 501 aa AA seqDB search
MTEAEAPTADLLIVGGGINGAAIARDAAGRGLSVVLCERGDIASHTSSASTKLIHGGLRY
LEQFEFALVGKALAERKRLLRMAPHIIWPLRFVLPHQPHLRPAWMIRIGLFLYDRLGGRR
SRELPGSRSVNLRKHIAGRPLREEFSRGFVYSDAWVQDARLCVLNAMDAAERGAQVWVRT
ACIGAERGARHWQAQLRGPDGALRQVRARALVNATGPWAASFLDQVAHVAHQRNLRLIKG
SHIVVPRLFDHDHAYIFQQPDRRIVFAIPYEHDYTLIGTTDVDYREDPSAPRISTQEIDY
LCAAATRYFQRPVLAEDVVWTYSGVRPLLDDDSDKASQVTRDYVLDLDREGAPLLSVFGG
KITTARKLAEEACDTLAPLLDNRRGTWTGASKLPGGDLPDADFEAFFEDFSLRRPWLPDP
LAYRLCRNYGSRALRIVESCVRLEDLGERFGADLYRAEVDYLIDFEWARTAEDILWRRSK
LGLRFDAAGREALQRYVAQRT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcagaagcacccacggccgacctgctgatcgtcggcggcggcatcaacggc
gcggcgatcgcgcgcgacgcggccggacgcggattgtccgtggtgctgtgcgagcgcggc
gacatcgcctcgcacacatccagcgccagcaccaagctgatccatggcgggctgcgctat
ctcgaacagttcgagttcgccctggtcggcaaggccctggccgaacgcaagcgcctgctg
cgcatggccccgcacatcatctggccgctgcgcttcgtgctgccgcaccagccgcacctg
cgtccggcgtggatgatccgcatcggcctgttcctctacgaccgcctcggcgggcgccgc
agccgcgagctgccgggctcgcgctcggtcaacctgcgcaagcacatcgccgggcggccg
ctgcgcgaggaattcagccgcggcttcgtctattccgacgcctgggtgcaggacgcgcgg
ctgtgcgtgctcaacgccatggacgcggccgaacgcggcgcgcaggtgtgggtgcgcacc
gcctgcatcggcgccgaacgcggcgcgcggcactggcaggcgcaactgcgcggccccgac
ggcgcgctgcgccaagtccgcgcgcgcgccctggtcaacgccaccgggccgtgggcggcg
agcttcctcgaccaggtcgcgcacgtcgcccaccagcgcaacctgcgcctgatcaagggc
agccacatcgtggtgccgcgtctgttcgaccacgaccacgcctacatcttccagcagccc
gaccggcgcatcgtgttcgcgattccctacgaacacgactacaccctgatcggcaccacc
gacgtggactaccgcgaagacccgtcggcgccgcgcatttccacccaggaaatcgactac
ctgtgcgccgccgccacgcgctatttccagcgtccggtgctggccgaggacgtggtctgg
acctacagcggcgtacgcccgctgctcgacgacgacagcgacaaggcctcgcaggtcacc
cgcgactacgtgctcgacctcgaccgcgaaggcgcgccgctgctgagcgtgttcggcggc
aagatcaccaccgcgcgcaagctcgccgaggaagcctgcgacaccctggcgccgctgctg
gacaaccgccgcggcacctggaccggcgcctccaagctgcccggcggcgacctgccggac
gccgatttcgaggcgtttttcgaggacttcagcctgcgccggccgtggctgccggacccg
ctggcctaccgcctgtgccgcaactacggcagccgcgcgctgcgcatcgtcgagagctgc
gtgcgcctggaggacctcggcgagcgcttcggcgccgatctgtaccgggccgaagtggat
tacctgatcgacttcgaatgggcgcgcacggccgaagacatcctgtggcggcgctccaag
cttgggctgcgcttcgatgccgcggggcgcgaggccctgcagcgctatgtcgcgcagcgc
acatga

DBGET integrated database retrieval system