KEGG   Lysobacter enzymogenes C3: GLE_2678Help
Entry
GLE_2678          CDS       T04371                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
lez  Lysobacter enzymogenes C3
Pathway
lez00380  Tryptophan metabolism
lez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lez00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    GLE_2678 (kynU)
Enzymes [BR:lez01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     GLE_2678 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ALN58026
UniProt: A0A0S2DHM5
LinkDB All DBs
Position
3012331..3013617
Genome map
AA seq 428 aa AA seqDB search
MTDLHTPAHAAALDAADPLPTLRHEFLIPRHGEEEQAYFVGNSLGLQPRGARAHVEEVMD
KWAMEAVEGHFTGQAQWMPYHELVREPLARLVGALPHEVVAMNSLTANLHFMLVSFYRPT
RERPAILMEAGAFPSDRYALASQVGFHGFDPDTDLIELQPDGPGGVFSMESIERAIAEHG
PRLALVLWPGVQYRTGQAFDLARIAALAHAQGALCGFDLAHGVGNLELNLHDSGADFAVW
CHYKYLNAGPGAVAGCFVHERHARSDRPRFAGWWGHESATRFRMGPEFVPTPGAEGWQLS
NPPILGLAPLRASLDLFDRVGMRALREKSLRLTGYLESLIRARLGETLDILTPAEPARRG
CQLSLRVIGGRGLSGRAAGRDLFEDLARRGVLGDWREPDVIRISPAPLYNTHGDIVRFVA
AVEAWRDA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgcacacgcccgcccacgccgccgcgctcgacgccgccgacccgctgccg
acgctgcgccacgagttcctaatcccgcgccacggcgaggaagaacaagcctatttcgtc
ggcaactcgctcggcctgcagccgcgcggcgcgcgcgcccatgtcgaggaagtcatggac
aagtgggcgatggaagcggtcgaaggccacttcaccggccaggcgcagtggatgccgtac
cacgagctggtgcgcgaaccgctcgcgcgcctggtcggcgcgctgccgcacgaggtggtg
gcgatgaattcgctgaccgccaacctgcacttcatgttggtcagcttctatcggcccacc
cgcgagcgtccggcgatcctgatggaagccggcgcgttcccgtccgatcgctacgccctg
gcctcgcaggtcggtttccacggcttcgatcccgacaccgacctgatcgaactgcagccc
gacggccccggcggcgtgttctcgatggagagcatcgagcgcgccatcgccgaacacggc
ccgcgcctggcgctggtgttgtggccgggcgtgcagtaccgcaccggccaggccttcgac
ctcgcgcgcatcgccgcgctcgcgcacgcgcaaggcgcgctgtgcggcttcgatctcgcc
cacggcgtcggcaacctggagctgaacctgcacgacagcggcgccgacttcgcggtgtgg
tgccattacaagtacctcaacgccggccccggcgcggtcgccggctgcttcgtccacgaa
cgccacgcacgcagcgatcgcccgcgcttcgccggctggtggggccacgaatcggcgacc
cgcttccgcatgggtcccgaattcgtgcccacgccgggcgccgaaggctggcagctcagc
aacccgccgatcctcggactggcgccgctgcgcgcctcgctggacctgttcgaccgggtc
ggcatgcgcgcgctgcgcgagaagtcgctgcgcctgaccggttacctggaatcgctgatc
cgcgcgcgcctgggcgaaaccctggacatcctgaccccggccgagccggcccggcgcggc
tgccagttgtcgctgcgggtgatcggcggccgcggcctcagcggccgcgccgccggccgc
gacctgttcgaagacctggcccgccgcggcgtgctcggcgactggcgcgaacccgacgtg
atccggatttcgccggcgccgctgtacaacacccacggcgatatcgtgcgcttcgtcgcg
gcggtggaggcgtggcgggacgcgtga

DBGET integrated database retrieval system