KEGG   Lysobacter enzymogenes C3: GLE_5046Help
Entry
GLE_5046          CDS       T04371                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lez  Lysobacter enzymogenes C3
Brite
Enzymes [BR:lez01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GLE_5046 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALN60387
UniProt: A0A0S2DPL1
LinkDB All DBs
Position
complement(5621420..5621995)
Genome map
AA seq 191 aa AA seqDB search
MNATLRIAVLAAATAALAACGGQSVKPTPPPAATAKPVSTASSASVVLASASGSLVSGKL
NVRPMGDGVHITGEIGGLTPNSTHAIHIHEKGDCSAADATSAGGHFNPAAQPHGQVDHGA
HHAGDMDNLVANAEGVAKVDAHASGVTLGGGAPNDVAGRAVIVHASADDYKTQPTGNAGA
RLACGVIKTGR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgactcttcgcatcgccgtcctcgccgccgccaccgccgcgctcgccgcgtgc
ggcgggcagtccgtcaagcccacgccgccgccggccgcgaccgccaagccggtgtccacc
gccagttcggccagcgtggtgctggcctcggcgtcgggcagcctggtcagcggcaagctc
aacgtgcgtccgatgggcgacggcgtgcacatcaccggcgagatcggcggcctcaccccg
aacagcacccacgccatccacatccacgagaagggcgattgcagcgccgccgacgccacc
agcgcgggcggccacttcaatccggccgcgcagccgcacggccaggtcgatcacggcgcg
caccacgccggcgacatggacaatctggtcgccaacgccgaaggcgtggccaaggtcgac
gcgcacgccagcggcgtgaccctcggtggcggcgcgcccaacgacgtcgccggccgcgcg
gtgatcgtccacgcttcggcggacgattacaaaacccagccgaccggcaacgccggcgcg
cgcctggcctgcggcgtgatcaagaccggccgctga

DBGET integrated database retrieval system