KEGG   Legionella fallonii: LFA_0201
Entry
LFA_0201          CDS       T03771                                 

Gene name
prlC
Definition
(GenBank) oligopeptidase A
  KO
K01414  oligopeptidase A [EC:3.4.24.70]
Organism
lfa  Legionella fallonii
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lfa01002]
    LFA_0201 (prlC)
Enzymes [BR:lfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.70  oligopeptidase A
     LFA_0201 (prlC)
Peptidases and inhibitors [BR:lfa01002]
 Metallo peptidases
  Family M3
   LFA_0201 (prlC)
SSDB
Motif
Pfam: Peptidase_M3 PMC2NT
Other DBs
NCBI-ProteinID: CEG55679
UniProt: A0A098G118
LinkDB
Position
I:225214..227235
AA seq 673 aa
MSAIVGLPQFSHIDVDGFKTHLDAMLKGHLEQIKTLLETNRHYTWDNLMYPLDDLSDELE
RFWSPLSHLHSVMNSPALRECYQGCLPLLSEYESAVGQNQKLYEAIKSIDTSHLDAAQQK
IIADSLLDFELSGVALSKEDKKRFEAIQTRLDELSNQFQNNVLDATQAFTLQITDPARLA
GLPEHALNTAKELATEKGLEGHVLTLEYPCYQAVMAYGEDRSLREEIYQAYVTRASEQGP
NAGQFDNTALIDEILALRHEQAKLLGFHNYAELSLATKMAESSNQVINFMEDLVKKAGEQ
AKEEFKQLQQFAAERFQLDKVQPWDVGYLSEKRRQDLYTLSQEELRPYFPHPKVMQGLFD
IVKKLYGMTIQEIDGVDVWHKDVQCFCVVDQHNQVRGYVYTDLYARPNKRGGAWMDSLQS
RRKLEDGHVQLPIATLSCNFAKASANKPAMLSHDEVITLFHEFGHCLHHILTQVDYMGGS
GINGVEWDAVELPSQFFENWCWVQEALTMLTSHVDTGEMLPETIFERLMAAKNFQSAMAM
LRQIEFALFDFLIHKDFDAERKALVSDTLAKVRTKTNVIPIAPYNRFQHSFSHIFGGGYA
AGYYSYSWAEVLSSDAFARFEEEGVFNPKTGLDFLSHILEAGGSKKASEAFVAFRGRPAT
VDALLRHNAIQQR
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgtctgcaatcgttggattaccccagtttagccatattgatgtagatggatttaaaact
catcttgatgccatgctaaaaggtcatctagagcaaattaaaaccttgctagaaaccaat
cgccattacacttgggataatttaatgtatcccttggatgatttatctgatgaactagag
cgcttttggtctccattatctcatctacattcggtgatgaactcaccagccttacgcgaa
tgttaccaaggatgtttacctttactatcagagtatgaatcggccgtagggcaaaatcag
aagttatatgaagcgattaaatccatagatacgtcgcacttagatgccgcacaacaaaaa
attattgcggacagtcttctggattttgaattatcaggagttgctttatccaaggaagat
aaaaaacgctttgaggccatacaaacacgtttagatgaattatctaaccaatttcaaaat
aatgttcttgatgcaactcaagcctttaccttacagattactgatccggcacgtttggct
ggcttaccagagcacgcattaaatacggctaaagaattggcaactgaaaaaggtctagag
ggacatgtattgacgttagaatatccctgttatcaagcagtaatggcttatggagaagac
aggagtttgcgggaagaaatctatcaagcttatgtcactagagcttcggagcagggacct
aatgcaggacaattcgataatacagctttgattgacgaaatactggctctgcgtcatgaa
caggccaagcttctagggtttcataattatgctgagctgtcattggctactaaaatggca
gagtcttccaatcaagtgattaactttatggaggatttggtcaaaaaagctggcgaacaa
gcgaaagaagaatttaaacaattacagcagtttgcggcagagagattccagttagataag
gtacagccttgggatgtaggttatttatcggaaaaaagaaggcaagatctctatacttta
tcacaagaagaactacgtccttattttcctcatcctaaagtaatgcaaggtttgtttgat
atcgttaaaaagctatacggtatgacgattcaagaaattgatggtgttgatgtttggcat
aaagacgtgcaatgtttttgtgttgttgatcaacacaaccaagttcgtggttatgtttat
actgatttatatgcaagacccaataaacgtggtggcgcatggatggattctttgcaaagt
agaagaaaattagaagatggtcatgtgcaattacccatagcgaccttaagctgtaatttt
gctaaagcatcagccaataaacccgcaatgctgtctcatgatgaagtgattactttattc
catgagtttggccattgtttgcaccatatcttaacgcaagtggattatatgggcggctct
ggtattaacggagttgagtgggatgcagtggaattacccagtcagttttttgaaaattgg
tgctgggtgcaagaggctctcaccatgctgacctctcatgtcgacaccggtgaaatgctt
ccggagaccatattcgaacgcttaatggccgcgaagaactttcaatctgccatggctatg
ctaaggcaaatagagtttgcattatttgattttctgatccataaggatttcgatgcagaa
agaaaagcgctggtttctgatactttagctaaagttcgtactaaaactaatgtgatcccc
attgctccttacaaccgcttccaacacagtttcagccatatctttggtggaggctatgcg
gcaggctattacagttacagctgggccgaggtcttatctagtgatgcgtttgctcgtttt
gaggaagaaggagtatttaaccccaaaaccggacttgattttctaagccatattctagaa
gccggtggctccaagaaagcgtctgaggcttttgttgcctttagaggacgtcccgcaacg
gtagatgcgttattaagacataatgcaattcagcaaagataa

DBGET integrated database retrieval system