KEGG   Legionella fallonii: LFA_1326Help
Entry
LFA_1326          CDS       T03771                                 

Gene name
fabF
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
lfa  Legionella fallonii
Pathway
lfa00061  Fatty acid biosynthesis
lfa00780  Biotin metabolism
lfa01100  Metabolic pathways
lfa01212  Fatty acid metabolism
Module
lfa_M00083  Fatty acid biosynthesis, elongation
lfa_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LFA_1326 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LFA_1326 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lfa01004]
    LFA_1326 (fabF)
Enzymes [BR:lfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     LFA_1326 (fabF)
Lipid biosynthesis proteins [BR:lfa01004]
 Fatty acid synthase
  Component type
   LFA_1326 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: CEG56752
UniProt: A0A098G2N9
LinkDB All DBs
Position
I:1460431..1461669
Genome map
AA seq 412 aa AA seqDB search
MNKRRVVITGMGMLTPVGLNVQETWQNILAGVSGVGLVEDFDTTEYTTKIWAKVKNFNIE
NYVPIKDARKMDVFTQYGIAAAEEAMLDSGLIMNEALSRRTGVAVGAGIGGIQTITNNQD
RLVAGGPRKVSPFFIPAGIINMVAGQISIKHNLKGPNISVVTACTTGTHNIGLAGRIIAY
GDADVMVCGGSEMTTTPLCLAGFSAVRSLSKRNDEPQKASRPWDKDRDGFVMGEGAGILV
LEEYEHAKARGAKIYAELVGFGMSGDAYHITAPDEDADGAARSMEAAIHDAGIAPNQVDY
INAHGTSTELNDLNETKAIKRIFQEHAYDLAVSSTKSMTGHLLGAAGAVEAIFSVLALRE
QIAPPTINLDNPDEGCDLNYVAHKPQKRSINYVLSNSLGFGGTNGSLLFKRI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaacggcgtgtagtaattaccggtatggggatgcttactccagtcggtcttaat
gtacaggaaacttggcaaaacatattggctggagttagtggggtcggactggtagaggat
tttgatactactgaatacactactaagatttgggctaaggtcaagaattttaacattgag
aattacgtgcccatcaaagatgctcgaaaaatggatgtatttactcagtatggaattgcc
gccgcagaagaggcgatgcttgattcaggtttaataatgaatgaggctttgtctcgtcgt
actggtgttgctgttggcgctggtataggcggtattcagactattactaataaccaggac
agactggttgcaggaggcccacgtaaggtttctcctttttttattccagcaggcataatt
aatatggttgctgggcaaatttctattaaacacaatcttaaagggcccaatatatcggtt
gtaaccgcatgtacaactggcactcataatattggacttgctggccgtataattgcctat
ggtgatgcggatgttatggtttgtggtggttctgaaatgaccacaacacctttatgctta
gcaggtttttctgcagtacgttctctttctaagcgcaatgatgaacctcaaaaagcatca
agaccttgggataaagacagagatggatttgttatgggtgagggagccggtattctggtt
ttagaagaatacgagcatgcaaaagcccgcggtgctaaaatttatgcggaattagtcggt
tttggtatgtcaggagatgcttatcatattaccgcacctgatgaagatgctgatggtgct
gctcgctccatggaagcggctattcatgatgcaggtatagctcctaaccaagtagattat
attaatgcgcatgggacttcaacagaacttaatgatctgaatgaaactaaggctatcaag
cgtattttccaagagcatgcttatgacttagcagttagctctacaaaatcaatgaccggg
cacttattaggagcagctggcgctgtagaagccatcttcagtgttttagcgctaagagag
caaatcgctcctcccacaattaatttagacaaccctgatgaaggttgtgacttgaattat
gttgctcataaaccccaaaaaagaagtattaattacgtcttaagtaattcattgggtttt
ggtggaacaaatggtagtttgctatttaaacggatttaa

DBGET integrated database retrieval system