KEGG   Legionella fallonii: LFA_1358Help
Entry
LFA_1358          CDS       T03771                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lfa  Legionella fallonii
Pathway
lfa00564  Glycerophospholipid metabolism
lfa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LFA_1358 (glpD)
Enzymes [BR:lfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LFA_1358 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_oxidored HI0933_like GIDA Pyr_redox 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CEG56781
UniProt: A0A098G479
LinkDB All DBs
Position
I:complement(1494413..1495936)
Genome map
AA seq 507 aa AA seqDB search
MEQVFDVAIIGGGINGCGCAADAALRGLSVVLFEQDDLASKTSSSSTKLIHGGLRYLENY
EFALVKKALEERQVLLNLAPHLVHPQSFILPYQKHMRPAWLLRLGLFFYDHLSRKNHLPK
CKSIKRTKKNNYFTPLIDQIKRGFLFYDASTDDARLTITNALQAKNHGASIRPNSKVTQI
EAGNKIWQLTIQPKSGTPYKIKAKSLINAAGPWVAPIAQLTQIAVNREITLVKGSHIIVP
QLYEGKHAYFLQHDDKRVIFVIPYHGFSMIGTTDTLFNESINSPVRISVEEIDYLLNLVN
TYFKSQLSSKDLIFSWSGVRPLLSSEGKDLKALSRDYSYEFNITPAPIVTIFGGKITTYR
QLAEETINQLVSIFPQMQSCKTKRTPLPGATFGTVNFEQYLIYARKKYHWLDKELLNRYL
YSYGSCTEHFLSKCTSIESMGKRYGTSLYQVELDYLISEEWARHIEDILERRTKLGLVID
SSSKKELENYLTNINHCPADQSESVCH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagtttttgatgttgcaattattggcggcggcatcaatggttgtggttgtgcc
gctgatgcagccttacgaggactatctgtagtactcttcgaacaagatgacctagcttcc
aaaacctcctcaagtagtactaaattaattcatggaggattaagatacttagaaaactat
gagtttgctttggtaaaaaaagcgttagaagaaagacaagtattattaaatctagcgccg
catttagtacatcctcaatcatttatcttgccttaccaaaaacacatgcgcccggcctgg
ttattaagattgggcttatttttttacgaccatttaagccgaaaaaatcatttgcctaaa
tgtaaatcgatcaagagaacaaaaaaaaataattatttcaccccattaattgatcaaata
aaacgaggattcttgttttatgatgcatcaacagatgacgctcgtttaacgattactaac
gccctacaggctaaaaatcacggagcgagcattcgtcctaattctaaagtgacacagatt
gaagcgggtaacaaaatttggcagttaacgatacaaccgaagtcaggaacaccctataaa
atcaaggctaaatctttgattaatgcagcggggccctgggttgctcccatagcgcaactt
acccaaatagcggtgaaccgtgaaataaccttagtaaaaggaagccatattatagttcct
caactctatgaagggaaacatgcctactttttacaacatgacgataaacgcgtaatattt
gttattccttaccacggctttagtatgataggaactaccgatacattattcaacgagtcc
atcaatagccccgtgcgaattagtgtagaagaaatagattatctattaaatttagtaaat
acatattttaaatcgcaactaagttctaaagaccttattttttcctggagtggagttaga
cctttattatctagcgaaggaaaggatttaaaagccttaagcagagattatagttatgaa
tttaatatcacgcccgcgcccattgttactatttttggaggaaaaatcacaacctatcgc
caattagctgaagaaactattaatcaattggtctctattttccctcaaatgcaatcgtgt
aaaacaaagcgcactcctcttcctggagctactttcggcacagtcaattttgaacaatat
ctgatttatgcgagaaaaaaatatcattggcttgataaagaactacttaatcgctatcta
tacagctatggaagttgcacagaacattttctatctaaatgtaccagcatcgaatccatg
gggaaaagatacggcacatccctctatcaagttgaattagattatttaatctcagaggaa
tgggccagacatattgaggacatactagagcgcaggactaagcttggattagttatagat
agttctagcaaaaaagaactagagaactatctaaccaatattaatcattgtcctgctgat
caatctgagtccgtatgtcactaa

DBGET integrated database retrieval system