KEGG   Legionella fallonii: LFA_1527Help
Entry
LFA_1527          CDS       T03771                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacC
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
lfa  Legionella fallonii
Pathway
lfa00550  Peptidoglycan biosynthesis
lfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LFA_1527 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lfa01002]
    LFA_1527 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lfa01011]
    LFA_1527 (dacC)
Enzymes [BR:lfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LFA_1527 (dacC)
Peptidases [BR:lfa01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   LFA_1527 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:lfa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LFA_1527 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: CEG56943
UniProt: A0A098G3A2
LinkDB All DBs
Position
I:1686188..1687411
Genome map
AA seq 407 aa AA seqDB search
MSRATSFLLTTLFFITLFVQSTNSTAEDSLPNNDLQRPSPTVTNKPLVTPAAPALNAKAY
ILIDVNSGKIIAEKNSEERLPPASLTKMMTLYVVSNALHQGQIHLDDSVRVSRDAWRIGG
SRMFIKEGQQVLVEDLLKGIIVDSGNDACVAMAEHVGGTENAFADIMNQQAQNLGMKNSH
FTDSTGLPDPNLYTTAKDLAILGRALISDFPQYYSWYKQKWFTYNGIRQPNRNRLLWRDN
QVDGLKTGHTAEAGFCLVSSAKRGNMRLLAVVLGEPNDSSRADDSEKLLNYGFRFFETHQ
LYKSGQSISEMQLYKGAVDKVTVGLTDDQFITIPAGQYQRLNISTNVPSYLQAPINKGDK
VGELVVKFDDNVVATRPLYALQSVESGGFFTRAKDSIRLTFKSWFGS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcagagctacctcttttttattaacgacactgttttttatcactctttttgtgcaa
tctaccaattcgactgcagaagattcattgcctaataatgatttgcaaagaccgtcccct
actgttactaacaaacctttagtgactcctgcagcaccagcccttaatgccaaagcctac
attcttatcgatgtaaatagcggtaaaattattgctgaaaaaaatagtgaagagcgttta
cctcctgctagtttgactaagatgatgacattatatgttgtatctaacgcactacatcaa
ggccagatacatttagatgatagtgtaagagttagtcgtgatgcatggagaattggtggt
tcccgtatgtttattaaagagggccaacaagttttagttgaagatttattaaaaggcatc
atcgtagactccggtaatgatgcttgtgttgccatggctgagcatgttggaggcactgaa
aacgccttcgctgacatcatgaaccagcaagcacaaaatttaggaatgaaaaacagccac
tttactgacagtacaggtttaccagatcctaatttatacacaactgctaaagacctagct
atcttaggtagagcattaattagtgattttcctcaatactacagctggtataagcaaaag
tggtttacttataatggcatacgtcaacccaatagaaaccgtttattatggagagataac
caagttgatggattgaaaactggacacacagctgaagcaggcttttgtcttgtttcctca
gcaaaacgtggcaacatgcgtttattagctgttgtattaggagaacctaatgactcatct
cgtgcagatgatagtgaaaaattactaaactacggttttagattctttgaaacgcatcaa
ttatataaatcaggccaatccatctccgaaatgcagctgtataaaggtgcagttgacaaa
gtaactgttggattaactgatgatcaattcattacgattccagcaggccaataccaaaga
ctgaatatttcaactaacgttccttcttatttacaagcccctataaataaaggcgataag
gtgggtgagttggtagtaaaatttgatgataatgtagtagctacccgtcctttatatgca
ctgcaatcagttgaatctggtggattttttacgagagccaaggactcaattcgcttaaca
ttcaaaagctggtttggctcttag

DBGET integrated database retrieval system