KEGG   Legionella fallonii: LFA_1654Help
Entry
LFA_1654          CDS       T03771                                 

Definition
(GenBank) protein of unknown function
  KO
K18626  trichohyalin
Organism
lfa  Legionella fallonii
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lfa04812]
    LFA_1654
Cytoskeleton proteins [BR:lfa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    LFA_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orthopox_A49R
Motif
Other DBs
NCBI-ProteinID: CEG57061
UniProt: A0A098G521
LinkDB All DBs
Position
I:complement(1817081..1820809)
Genome map
AA seq 1242 aa AA seqDB search
MKLSELNELYITEKYLFKQSKDYVFGGNKDIELPEDITDFIRKLNNNEIIRKEEFQSFSE
SLLQLNKDVQDCIIFLLYYMTDPVFDIHYKDDITEAVNSIESSLNARREIPQSSGDDAEK
YIRLVNYYYLFSHYRPKSNDYYGYAYPGTNSWDTNVRYNLPFAINALRLVGKLPTTPDFN
GIDLSKPYFPLHLQVVKKEKVTIRKGIPDSEKFYPYKMVAKLFKGNTGDNTFLATNGKKK
IFIRGVEDYAPHAVLASKIASIISPTHFSIERLLNNRLVGARGIPGYARSAADDETRDAR
KKYIDKNKRIFPGTGIIDEVTNFVGESDPNIENYGFSSEDIDNSHLSKIDFDRCDVDSEI
PKELYERNILTKPRRGLYHGATHVQTNPEYIKEKLYARLKLSMLTEPLFSKLANKAFAAE
DHELQKKAIKELTNRSNIALELFFEHPDVKSFLTQNPSTLSQCYSEITNYISTHFVEQDR
ELIQHSLAKRVGNIHEEIKKTLDINLPLSMDKKNSFAELNPKDKASEEPHQEEAHKEQQR
LQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQE
QQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQE
KQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQR
QEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQSLQEQQEKQRQEE
ARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARK
EQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQ
RLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQ
EQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQ
EKQRQEEARKEQQRLQEQQEKQRQEEARKEQQRLQEQQEKQRQEEARIEQRSMKDQLKKQ
RQVEACKEQPDPEQTICNEYHRDFNKAIDVLKQKMEEFKRDPDFEKNPKLQEAHKAANKL
YNKLERTGNSYFTKEPSQEEYDNFKLCCKTHIDEARSVLNEHRGWKKILINVVAIIVTAG
IGYAIAAGINIAMNKGKFTFFATDSSEKLDVIEEHIKNKVGK
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagtgaattaaatgaactctatataacagaaaaatatttgtttaaacaatcg
aaagattatgtatttggaggaaacaaagacattgaactccctgaggatatcactgatttt
ataagaaagcttaataataatgagataattagaaaagaagagtttcagagtttctcagaa
agcttattacaacttaataaagatgtccaagactgtatcatttttctactttattacatg
accgacccagtgtttgatattcattataaagatgacattacagaggcagtaaatagtatt
gaaagtagtctgaatgccagacgtgaaataccccaaagctcgggtgatgatgctgaaaaa
tatattagattagtaaattactactatctcttttctcattatcgaccgaaaagtaacgac
tattatggttatgcctatccaggaactaattcttgggacactaatgtacggtacaatctc
ccttttgctattaatgcactccgattagtaggaaaattgcctacaactcctgatttcaat
ggtatcgacttaagcaaaccttattttcctttacacctgcaagtagtaaaaaaggagaaa
gtaactataagaaagggcattccagacagcgagaaattttatccatacaaaatggtagct
aaactcttcaaaggaaatacaggagataatacttttttggcaactaatggtaaaaagaag
atatttattcgtggtgtcgaggattatgccccacatgctgttttagcttcgaaaattgca
agcatcattagcccaacccatttttctatagaaaggttattgaacaatcgcctggtagga
gcaagagggattccaggttacgcccgctctgcagccgatgatgaaactagagatgctaga
aagaaatacatagataaaaataaacgaatatttcctggaacagggattatagatgaagtg
actaattttgttggtgaaagcgatcccaatattgaaaactatgggttctcttctgaagat
atagataatagtcatttgtccaaaattgattttgatagatgtgatgttgattcagaaatc
cccaaagaactatatgaacgaaatattttaactaaaccacgaagaggactttatcatggg
gccactcatgtacaaactaatcctgaatatatcaaggaaaaattatatgctcgattaaag
ctatctatgctcaccgagcctctattcagtaaactggctaataaagcctttgccgctgaa
gatcatgagctccaaaagaaagccatcaaagaactcaccaatagaagtaatattgccttg
gaactattttttgaacatccagatgtaaaatcttttcttactcaaaatccctcaactctt
agccaatgttacagtgaaataacaaactatatatcaacccattttgtggaacaggatcga
gagttaatacaacactcattagctaagcgtgtaggtaatattcacgaagaaataaagaaa
acgttagatattaacttacctctatcaatggacaaaaagaatagctttgctgagcttaat
ccaaaagataaggcaagtgaggagccacaccaagaagaagcgcataaagaacaacagcgt
ctgcaagaacaacaagaaaaacaacgccaagaagaagcacgtaaagaacaacagcgtctg
caagaacaacaagaaaaacaacgccaagaagaggcgcgtaaagaacaacagcgtctgcaa
gaacaacaagaaaaacaacgccaagaagaagcacgtaaagaacaacagcgtctgcaagaa
caacaagaaaagcaacgccaagaagaggcgcgtaaagaacaacagcgtctgcaagaacaa
caagaaaaacaacgccaagaagaagcgcgtaaagaacaacagcgtctgcaagaacaacaa
gaaaaacaacgccaagaagaagcacgtaaagaacaacagcgtctgcaagaacaacaagaa
aaacaacgccaagaagaagcgcgtaaagaacaacagcgtctgcaagaacaacaagaaaaa
caacgccaagaagaagcacgtaaagaacaacagcgtctgcaagaacaacaagaaaaacaa
cgccaagaagaagcacgtaaagaacaacagcgtctgcaagaacaacaagaaaaacaacgc
caagaagaagcgcgtaaagaacaacagcgtctgcaagaacaacaagaaaaacaacgccaa
gaagaagcacgtaaagaacaacagcgtctgcaagaacaacaagaaaaacaacgccaagaa
gaagcgcgtaaagaacaacagagtctgcaagaacaacaagaaaaacaacgccaagaagaa
gcacgtaaagaacaacagcgtctgcaagaacaacaagaaaaacaacgccaagaagaagca
cgtaaagaacaacagcgtctgcaagaacaacaagaaaaacaacgccaagaagaagcacgt
aaagaacaacagcgtctgcaagaacaacaagaaaagcaacgccaagaagaggcgcgtaaa
gaacaacagcgtctgcaagaacaacaagaaaaacaacgccaagaagaggcgcgtaaagaa
caacagcgtctgcaagaacaacaagaaaagcaacgccaagaagaggcgcgtaaagaacaa
cagcgtctgcaagaacaacaagaaaaacaacgccaagaagaagcgcgtaaagaacaacag
cgtctgcaagaacaacaagaaaaacaacgccaagaagaagcacgtaaagaacaacagcgt
ctgcaagaacaacaagaaaaacaacgccaagaagaagcacgtaaagaacaacagcgtctg
caagaacaacaagaaaagcaacgccaagaagaggcgcgtaaagaacaacagcgtctgcaa
gaacaacaagaaaagcaacgccaagaagaggcgcgtaaagaacaacagcgtctgcaagaa
caacaagaaaaacaacgccaagaagaggcgcgtaaagaacaacagcgtctgcaagaacaa
caagaaaaacaacgccaagaagaagcacgtaaagaacaacagcgtctgcaagaacaacaa
gaaaaacaacgccaagaagaggcgcgtaaagaacaacagcgtctgcaagaacaacaagaa
aagcaacgccaagaagaagcacgtaaagaacaacagcgtctgcaagaacaacaagaaaaa
caacgccaagaagaagcacgtatagagcaacgaagcatgaaagatcagctaaaaaaacaa
cgccaagtagaagcgtgcaaagaacaacctgatcctgagcaaactatctgtaatgaatat
catcgagactttaataaagcaattgacgttctaaaacaaaaaatggaggagttcaaaaga
gatcctgatttcgaaaaaaatccgaaattacaagaagcacacaaagccgcaaataaactt
tataataagcttgagcgaacaggaaatagctattttacgaaagagccaagccaagaagaa
tacgataatttcaagctatgctgtaaaactcacatagatgaagccagaagtgtgctgaat
gaacatcggggttggaaaaaaatacttataaatgtcgttgctataatagtgacagccgga
ataggatatgccattgctgctggcattaacatagctatgaataaggggaaatttaccttt
ttcgcaaccgatagttctgaaaaacttgatgtaatagaggaacatataaaaaataaagtc
ggaaaataa

DBGET integrated database retrieval system