KEGG   Legionella fallonii: LFA_2660Help
Entry
LFA_2660          CDS       T03771                                 

Gene name
accC
Definition
(GenBank) biotin carboxylase (A subunit of acetyl-CoA carboxylase)
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lfa  Legionella fallonii
Pathway
lfa00061  Fatty acid biosynthesis
lfa00620  Pyruvate metabolism
lfa00640  Propanoate metabolism
lfa01100  Metabolic pathways
lfa01110  Biosynthesis of secondary metabolites
lfa01120  Microbial metabolism in diverse environments
lfa01130  Biosynthesis of antibiotics
lfa01200  Carbon metabolism
lfa01212  Fatty acid metabolism
Module
lfa_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LFA_2660 (accC)
   00640 Propanoate metabolism
    LFA_2660 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LFA_2660 (accC)
Enzymes [BR:lfa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     LFA_2660 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     LFA_2660 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp LAL_C2
Motif
Other DBs
NCBI-ProteinID: CEG58028
UniProt: A0A098G6A5
LinkDB All DBs
Position
I:2947212..2948552
Genome map
AA seq 446 aa AA seqDB search
MLSKIVIANRGEIALRILRACKELGIQTVAVHSDVDKDLLHVRLADETVCIGPAPAQKSY
LNIPAIISAAEITDAVAIHPGYGFLSENADFADIVEQSGFRFIGPRGETIRLMGDKVSAI
EAMKKAGVPCVPGSGGPLGDDDNLNLKIANKIGYPVIIKAAGGGGGRGMRVVHSESNLLS
SIALTRSEAKAAFNNPTVYMEKFLENPRHVEFQILGDGKGHAIHLGERDCSMQRRHQKVL
EEAPAPGISAELRKEIGASVVKACKDLQYRGAGTFEFLYQDGCFYFIEMNTRIQVEHPVT
EQITGLDLIKEQIKIASDIPFTLNQEDIELRGHAIECRINAEDAKTFIPSPGTIKLLHQP
GGPGIRFDSHIYSSYTVPPNYDSMIGKLISYGATRAEAIARMRNALDEIIIDGIRTNIEL
HQRILHDKSFIDGGTNIHYLEKMLKG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtaaaattgttattgcaaatagaggcgagattgcgcttcgtatattgcgtgcg
tgtaaagaactaggcattcaaactgttgccgtccattctgatgtggataaagatttattg
cacgttcgtcttgccgatgaaacagtctgtataggtccagcccctgctcagaaaagttac
cttaatattccagccattatatctgcagcagaaattactgatgcggttgctattcatcca
ggctatggattcctctctgaaaatgccgattttgcagacatcgttgagcaaagtggcttt
cgttttattggtccacgcggagagactatacgccttatgggagataaagtatccgccata
gaagccatgaaaaaagcgggagtcccttgcgtccccggttcaggtggccctttaggcgat
gatgataatctcaatttaaaaattgctaacaaaattggttatccagtaattattaaagct
gccggtggtggtggtgggcgcggcatgcgcgtagttcacagtgaatccaatttattaagc
tctatagctctcacccgaagtgaagctaaagcagcgtttaataatccaacggtatacatg
gaaaaattcctagaaaatcccagacatgtcgaatttcagatactgggagatggaaaagga
catgcgattcatttaggagagcgcgattgctccatgcaaagacgccaccaaaaagtatta
gaagaagcacctgctccaggaatttctgctgagttacgaaaagaaattggagcatcagta
gtcaaagcctgtaaagatttacaataccgtggagctggaacctttgagtttttatatcag
gatggttgtttttattttattgaaatgaatacccgaatccaagtagaacatcctgtaaca
gaacagatcaccggccttgatctgattaaagaacaaatcaaaatcgccagtgatattcca
tttaccttaaatcaggaagatatagagcttcgcggacatgctatagaatgtagaatcaac
gccgaggacgctaaaacattcataccgtcgcctggaacaataaaattacttcatcagcca
ggagggccaggtatccgctttgattctcatatttacagtagctatacagtaccgcccaat
tatgactccatgataggcaagttgatcagctatggagcaacacgcgctgaagcaattgct
cggatgcgcaatgcgcttgatgaaattattattgatggcattagaaccaacattgaatta
catcaacgtattcttcacgacaaatcgtttatagatggcggtacaaacatccattattta
gaaaaaatgttgaaaggttaa

DBGET integrated database retrieval system