KEGG   Legionella fallonii: LFA_2690Help
Entry
LFA_2690          CDS       T03771                                 

Gene name
legY
Definition
(GenBank) Glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lfa  Legionella fallonii
Pathway
lfa00500  Starch and sucrose metabolism
lfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LFA_2690 (legY)
Enzymes [BR:lfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     LFA_2690 (legY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Phage_int_SAM_1
Motif
Other DBs
NCBI-ProteinID: CEG58057
UniProt: A0A098G6I1
LinkDB All DBs
Position
I:2980021..2981331
Genome map
AA seq 436 aa AA seqDB search
MEVMLKRIFFLLFFVASQAFSAVFNQEEITVLRQQFFTNFLANGAIVASPSRHEPNYYYD
WVRDSAIAMGLVENWYESTQLNQYKNLLFTYISWTETIQHQKDPNPGQDILGEPKFYVDG
YPFDHAWGRPQNDGPALRALVLIRFAQQLLAHQETEYVQTHLYNGGMDPHTMGAIKMDLE
YVAHHWQDANFDLWEEVYGHHFFTSIAQRKALLNGAALARRLNDNQAAAYYAKQADLITD
QLKYHIDPTHNIIQASLPFHSGPQKTLELDSSVILAILINQQTEGLYSPQNNLVKNTVKA
LHQQFNLMFPINKNNPGAILFGRYPGDTYDGYNTNSVGNPWFILTATIAEYYFTLANNVA
MNETNKTLIKGYLSTGDNYLRLIKKYAPEMHLSEQINLNTGIQQGAASLTWSYVAVLRAI
DLREKIEKKLMDSAIN
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggaggttatgttgaaacggatattttttttactgttctttgttgcttcacaagcattt
agcgctgtgtttaatcaagaagaaatcacagttttaagacaacaattctttacaaatttc
ctcgccaatggtgccatagttgcctctccttcgcgacatgagcctaattattattatgac
tgggtgcgtgactctgctatagcaatgggattagtggaaaactggtatgagtcaactcaa
ttaaatcaatataagaatcttttattcacctatatttcttggactgaaaccattcaacat
caaaaagatccaaatccggggcaagatattttgggcgaacctaaattttatgttgatgga
tatccttttgatcacgcttggggcaggccacaaaatgatgggccagcgcttagagcctta
gtattaattagattcgctcaacaattactggctcatcaagaaacggaatatgttcaaact
catctctacaatggaggaatggatccccacactatgggcgctattaaaatggatttagaa
tatgtagctcaccattggcaagatgccaactttgatctttgggaggaggtctatggtcac
cattttttcacctctatagcgcaaagaaaagcactgttaaatggagctgctcttgctcgc
cgcctcaacgacaaccaggcggctgcatattatgcgaaacaagccgatttgattactgat
cagctaaagtaccatattgatccgactcataatatcatccaagcatccctaccatttcat
agcggcccacaaaaaacattagagctggattcatcggtcattttagcaatactaatcaat
cagcaaacagaaggactctactccccacaaaataatttagtaaaaaatacagttaaggcc
ttgcaccagcaattcaatctgatgttccccattaataaaaataatccaggagccatattg
tttggtcgctacccaggtgatacttatgacggatacaatacaaatagtgtaggtaatcct
tggtttattctcactgcgactatagccgaatattattttactttggctaataatgtagca
atgaatgaaactaataaaacactgataaagggctatctaagcactggagataattattta
agactcattaaaaaatatgcgcctgaaatgcatctgagcgaacaaatcaatttaaatacg
gggatacaacagggggctgcttcattaacctggagctatgttgctgtacttagagcaatt
gacttacgagaaaaaattgaaaaaaaactcatggactctgcaataaattaa

DBGET integrated database retrieval system