KEGG   Legionella fallonii: LFA_2935Help
Entry
LFA_2935          CDS       T03771                                 

Definition
(GenBank) D-stereospecific peptide hydrolase (modular protein)
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
lfa  Legionella fallonii
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LFA_2935
Enzymes [BR:lfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LFA_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: CEG58290
UniProt: A0A098G9X6
LinkDB All DBs
Position
I:complement(3218994..3220274)
Genome map
AA seq 426 aa AA seqDB search
MRDNLRNKFGVFLICLTAVLGVDVSYAGCGQNINEGIQKIIDEERVKYHIPGIEVSISCP
GEDSPRDFVSGTTTLNGDVPIRPEHLFQIGSETKSFISAVILQLEAEGRLSIYDPIGNYL
KNIPEAWQDVTIQQLLNHTSGIFNYTEVVELWTALMTSDFKMQFSSDELISFVKNKEFNF
FPGLGWSYSNTNYILAGMVVQAVTGKSIEEEINTRLLQPLHLSNTYYYAGAYNDDMLQRM
AHGYSSIGLFPDEPKDITSQNMSWANAAGAIVSTSHDIAIWLRHLLTDDNLLSANQRQEL
LSLVDVENGQPLPFESDKVGYGLGVIRFNLPSGEIWGHDGGTFGFISHMSWLKCNDVVIT
AIVNHVDKSEADGLGSTAITMDLINFIQQADTTKQCQMGLMPSKRSLSKQLQSIRSLDRL
VPKRSQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcgagataacctacgaaacaaatttggagtttttttgatatgtttaacagctgtttta
ggcgttgatgtttcttatgccggatgtggacagaatattaatgaaggcattcaaaaaatt
attgatgaagaacgagtaaaatatcatataccaggcattgaagtgagtattagctgccct
ggtgaagattcaccacgcgattttgttagtggcacaacaacgttaaatggtgacgttccg
attaggcccgaacatttatttcaaattggcagtgaaacaaaatcgtttatctccgcagtt
attttacaacttgaagcagaggggcggttatccatatacgacccgattggcaattattta
aaaaatattcccgaggcctggcaagacgttacaattcaacaattactgaatcacaccagt
ggtatttttaattatactgaagtggttgagttatggaccgcactgatgactagtgatttc
aaaatgcaattttcctcagatgagttaatcagctttgtaaaaaataaagaatttaacttc
tttcctgggttgggttggagctattcaaacacaaactatattttagctggaatggtagta
caggctgtgactggcaaatccattgaagaggagattaatactcgtttattgcaaccatta
catctttccaatacttattattatgcaggcgcctataatgacgacatgctgcaacgcatg
gcacatggttattcatcaataggattgtttcctgatgaaccaaaagatattacaagtcaa
aatatgtcatgggcaaatgcggctggagctattgtttcaacatcacatgatatagccatt
tggctaaggcatttattgactgacgataacctattatccgcgaatcagcggcaagaatta
ctcagccttgttgatgtagaaaatggacaacccttgccgttcgaaagcgacaaagtgggt
tatggtttaggtgtgattagatttaatttaccatcgggtgaaatttggggacatgatggt
ggcacatttggatttatttctcatatgtcttggcttaaatgcaatgatgtggtgattact
gcgatcgtgaaccatgtggataaaagtgaagcagatgggcttggtagtacggcaataaca
atggatttaattaatttcatccaacaggcggatacaacaaagcaatgccagatgggattg
atgccaagcaagcggtctttatccaagcagctgcaaagtattcgtagtttagatcgactt
gttccgaagcgatcacaatga

DBGET integrated database retrieval system