KEGG   Legionella fallonii: LFA_2995Help
Entry
LFA_2995          CDS       T03771                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lfa  Legionella fallonii
Pathway
lfa00061  Fatty acid biosynthesis
lfa00780  Biotin metabolism
lfa01100  Metabolic pathways
lfa01130  Biosynthesis of antibiotics
lfa01212  Fatty acid metabolism
Module
lfa_M00083  Fatty acid biosynthesis, elongation
lfa_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LFA_2995 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LFA_2995 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LFA_2995 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lfa01004]
    LFA_2995 (fabI)
Enzymes [BR:lfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LFA_2995 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LFA_2995 (fabI)
Lipid biosynthesis proteins [BR:lfa01004]
 Fatty acid synthase
  Component type
   LFA_2995 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CEG58344
UniProt: A0A098G8M8
LinkDB All DBs
Position
I:3276878..3277645
Genome map
AA seq 255 aa AA seqDB search
MIIDLTNKKGLVTGISNEHSIAYGCAEQFRESNAELATTFLNAKAEPFMRPLALQVKSPL
ILPCNVQKEEEIIALFAAIEKKWGKLDFMLHSMAFAPKADLEGPLVECSKEGFLEAMDIS
CHSLIRLSKYAVPLMKNGGSILTMTYYGSQKVILNYNLMGVVKAALEASVRYLASELGAK
KIRVNAISPGPIKTRASSGIPNFNEYIDAEEQRSPLHHLVDIKNVGNLAAFLVSDAAVDI
TGQVHYVDAGYSIMG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgataattgatctgacaaataaaaaaggtttagtgaccggcatctccaatgagcacagc
attgcctatggatgtgcagaacaatttcgtgaatcgaatgcagaattggcgacaaccttt
cttaatgccaaagcagagcctttcatgcgtcccttggcactacaagtaaaatcccccctt
attcttccttgtaatgtgcaaaaagaagaagaaattattgcattatttgccgcgattgaa
aaaaaatggggaaagctggatttcatgttacattcaatggcttttgcccctaaagctgat
ttggaaggcccattagttgaatgttccaaggaaggattcctcgaggcgatggatatctcc
tgtcattctttaattcgactgtcgaaatacgcagtacccttgatgaaaaatggcggcagt
atcttgactatgacctattatggcagccaaaaagtcatacttaattataatttaatgggt
gtagttaaggccgcattagaagcgtcggttagatacctggctagtgaattaggagcgaaa
aaaattagagtcaatgccatttcacccggacctatcaaaacacgagcttcctctggaatt
cctaattttaatgagtatatagatgctgaagaacaacgttctccgttgcatcatttagtt
gatattaaaaatgtcggtaatttagcggcgtttcttgtcagcgatgcggctgtggatata
acaggtcaagtacattacgttgatgctggttactccattatgggttga

DBGET integrated database retrieval system