KEGG   Laceyella sacchari: C1X05_01735Help
Entry
C1X05_01735       CDS       T05304                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
lfb  Laceyella sacchari
Pathway
lfb00473  D-Alanine metabolism
lfb01100  Metabolic pathways
lfb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C1X05_01735
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C1X05_01735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lfb01011]
    C1X05_01735
Enzymes [BR:lfb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     C1X05_01735
Peptidoglycan biosynthesis and degradation proteins [BR:lfb01011]
 Precursor biosynthesis
  Racemase
   C1X05_01735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AUS10318
UniProt: A0A2I7SWR1
LinkDB All DBs
Position
310610..311818
Genome map
AA seq 402 aa AA seqDB search
MIHGRDAWIEVDLDAIMHNIKEFRRYLPQRTRVMAVVKANGYGHGAVPVARAALEAGASH
LAVAFVDEGVELRQAGINAPILVLGYTPPHAVGYALRNGLTLTVYRSEILEAVEQEAVRL
GVTARVHVKVDTGMGRLGVLPEEVSPLLAQAEGLGHVEVEGIFTHYATADEEEDAYARFQ
LQRFTDVVNQVRKRHNIPLVHIANSAGAIQLPEGAFDMVRIGISMYGFYPSAEVKRDAVD
LRPALSLKCRVAHVKKPPRGTGVSYGNTYTVSGQEWIAVLPIGYADGINRHLSNAGHVLV
KGKRVPIVGRICMDQLMIQVTDAMPVQVGDEVVIYGQQGGEKITVDEVASFLKTISYEVV
CALSHRLPRFYIKNGEIVDFINRLQYNPPRQWDNQLDKGEQF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgattcatggccgggatgcatggattgaagtggatcttgacgccatcatgcacaatatc
aaagagtttcggcgctacctgccacaacgcacccgagtgatggccgttgtcaaagccaat
ggctacggccatggtgctgtgccggtggctcgtgcggcgctggaagcgggtgcgagccat
ttggcggtcgcgtttgtcgatgaaggagtggaacttcgtcaggcaggcattaacgccccg
attttggtgttgggatacacgcccccacatgccgtcggctacgccttgcgaaatgggttg
acgctgactgtataccgctccgaaatattagaggcggtggaacaggaagcggttcgcttg
ggagttacggcacgggtgcatgtcaaagtggataccggaatgggccggttgggagtgttg
cctgaggaggtttccccccttctggcgcaagcggagggccttggccatgtggaagtggaa
ggcatcttcacccactatgccacggcagatgaagaagaggatgcttatgcgcgttttcaa
ttgcagcgcttcaccgatgtggtcaaccaagtgcgaaagcggcacaacataccgctggtg
cacatcgccaacagcgcaggagcgatccaattgcctgagggcgcgtttgacatggtgcgg
atcggcatcagcatgtatggcttttatccgtccgcggaggtgaagcgggatgcggtggac
ttgcggccggcgctatcgctgaaatgccgtgtcgcccatgtgaaaaaaccaccgcggggc
acgggcgtaagctatggaaatacgtacaccgtttcgggtcaagaatggatcgctgtcttg
cccatcggttatgcggatggtatcaaccgtcatctttccaatgcgggccacgtgctggta
aagggaaagcgtgtgcctatcgtcggtagaatttgcatggaccagttgatgatccaggtg
acagacgcgatgcctgtacaagtgggagatgaagtggtcatctacggccaacaaggcggg
gagaaaattaccgtggatgaagtggcgagttttttgaagacgatctcatatgaagtggtt
tgtgccttgagtcatcgattgccccgtttttatataaaaaacggagagattgttgacttt
ataaaccgtttgcaatacaatccaccaagacagtgggacaatcaactggacaagggtgaa
caattttag

DBGET integrated database retrieval system