KEGG   Laceyella sacchari: C1X05_02040Help
Entry
C1X05_02040       CDS       T05304                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lfb  Laceyella sacchari
Pathway
lfb00564  Glycerophospholipid metabolism
lfb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C1X05_02040
Enzymes [BR:lfb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C1X05_02040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AUS07727
UniProt: A0A2I7SP99
LinkDB All DBs
Position
358315..359961
Genome map
AA seq 548 aa AA seqDB search
MNGRQERLSAIKDEVELLVIGGGITGAGIALDAQSRGINTVLVEMQDFGAGTSSRSTKLV
HGGLRYLKQLEVQLVAEVGKERAIVYENGPHVTTPEWMMLPIIKGGTYGKLASSVGLAVY
DRLAGVKKSERRQMLNKEETLRKEPLLRKEGLKGSGYYVEYRTDDARLTLEVMKKAVEYG
AEVFNYVKVTELLYENGKVNGVKLRDQISGEEYTLRAKKIVNATGPWVDELREMDGSKHG
KTLHWTKGVHIVVDGSRFPLRQAIYFDTEDGRMVFAIPRDGKTYIGTTDTDYRDDLVHPR
VTETDRDYLISAVNSMFPEVKLTHADVETFWAGVRPLIHEEGKSPSEISRKDEIFHSKSG
LITIAGGKLTGYRKMAEKVVNLVAKELQQETGKTFATCHTDRIPISGGDVGGSAGFEVFV
KEKTKQGVELGFSEQQAEWLTRLYGSNVDHVYQWSTADGKAAAKRYGIPIELYASLMYGL
QHEMVQTPVDYLLRRTGAMLFDIAWVKRWQAGVVDLMADHCAWDEQTRMRREQELEQEIS
YVTEVVSD
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagacaagagcggttgagcgcgatcaaagatgaagtggaattgctggtgatt
ggtgggggaatcactggtgcggggatcgcccttgacgcgcaatcgcgcggtatcaacacg
gtattggtagagatgcaggatttcggcgccggtacatctagccggtcaaccaaactggtg
cacgggggcctgcgctacctgaagcaactggaagtgcaattggtggccgaagtgggaaaa
gaacgggccattgtgtacgagaacggaccgcatgtcaccactcccgaatggatgatgcta
ccgatcatcaagggtggcacatacggcaaattggccagctccgtcggcttggctgtttat
gaccggttggctggcgtgaagaaaagtgagcggcgccagatgttgaacaaagaggagacc
ttgcgcaaagagccgttgttgcgtaaagaagggttgaaaggctctggttattatgtagag
tatcgcacggatgatgcccgattgacgctggaagtgatgaaaaaggctgtcgaatacggc
gctgaagtgttcaactatgtgaaagtgaccgagctcctgtatgaaaacggcaaagtgaac
ggagtcaaactgcgggatcagatatcgggggaagaatataccctgcgtgccaaaaagatc
gttaatgccaccggcccttgggtagatgagttgagggagatggatgggtccaaacacgga
aaaacgctacactggaccaaaggggttcacattgtggtggatggcagccgtttcccattg
cggcaagctatttacttcgatacggaggatgggcggatggtgtttgccattccgcgcgac
ggcaaaacatatattgggacgacagacacagactatcgggatgatctcgtccatccccgc
gtgacagaaacagaccgggattacctaatatctgctgttaacagcatgtttccagaagtt
aaattgacccatgccgatgtggagacattttgggctggcgttcgtccgctgattcatgaa
gaagggaaatctccatcagagatctctcgtaaggatgaaattttccattccaaatctggt
ttgatcaccattgcgggaggtaagctcactggctatcgcaaaatggctgagaaggtggtt
aacctggttgcgaaagaactgcaacaggaaacagggaaaacatttgctacgtgccacacg
gatcgcattccgatttccggaggggacgtgggcggatctgccggctttgaagtgtttgtg
aaagaaaaaaccaaacaaggcgtggaactgggcttttctgaacagcaagcggaatggttg
acccggttgtacggttccaatgtggatcatgtctaccaatggtcaacggctgatggcaaa
gcggcagcaaagcgatatggcattccgattgaattgtatgcttccctcatgtatgggtta
caacatgaaatggttcaaacgcctgtggactatctgttgcgccgcacgggtgcgatgctg
tttgacatcgcctgggttaaacgctggcaagcaggagtggttgacttgatggctgatcac
tgtgcatgggatgagcagactcgtatgcgtcgggagcaggagctggagcaagaaatcagc
tatgtcacggaagtggtttccgactaa

DBGET integrated database retrieval system