KEGG   Laceyella sacchari: C1X05_08020Help
Entry
C1X05_08020       CDS       T05304                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lfb  Laceyella sacchari
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1X05_08020
Enzymes [BR:lfb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C1X05_08020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Thi4 K_oxygenase Glutaredoxin NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AUS08796
UniProt: A0A2I7SSD6
LinkDB All DBs
Position
1575687..1577216
Genome map
AA seq 509 aa AA seqDB search
MMLDADIKAQLAQYLQLMEGDVLLKVSAGSDDVSRDMLALVDELAAMSSHIKVEKTSLER
TPSFSVNRIGEDTGVTFAGIPLGHEFTSLVLALLQVSGRAPKVDQQVIDQIKNIKGEYHF
ESYISLSCHNCPDVVQALNVMSVLNPGISHTMIDGAAFKDEVESKEIMAVPTVFLNGEFF
GSGRMTLEEILAKLGSGPDASELSNKDPFDVLVVGGGPSGASAAIYAARKGIRTGIVAER
FGGQVMDTLGIENFISVKYTEGPKLVASLEEHVKEYGIDVMTPQRAKRLEKKDLIEVELE
NGAVLKSKAVIISTGARWRNLGVPGEAEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLYSLPNVTVLKNVQTKEITGTDKVNGITY
IDRATEEEHHIELQGVFVQIGLVPNTDWLRDTVECNRFGEIIVDKHGATSVPGVFAAGDC
TDSAYKQIIISMGSGATAGLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggatgcagatattaaagcacaacttgcccaatatcttcaattgatggaaggc
gatgtgcttctgaaagtaagcgcgggatcggatgacgtatcccgcgacatgcttgcttta
gtggatgaattggctgccatgtcatcccatattaaagtggagaagacatcattagagaga
acgccgagctttagtgtgaaccgaattggcgaagacactggagttacttttgccggcatt
cctctggggcacgaatttacctcattggtattggctttgttgcaagtaagcggaagagct
ccgaaggttgatcagcaggtcatcgatcaaattaaaaacatcaagggcgaataccacttt
gaatcctacatcagcttgagttgccacaactgtccggatgtcgtgcaagctctgaatgtg
atgagtgttctcaatcctggtatttctcacaccatgattgacggcgcggctttcaaggat
gaggttgaaagcaaagaaatcatggccgtgccaaccgttttcctaaacggtgagtttttt
ggcagcggccgcatgactcttgaggaaatcctcgccaagctggggagcggcccagatgca
tcggagctttctaataaagacccatttgatgtgcttgttgtcggtggcggtccgtctgga
gcgagtgcggcaatctatgcggcgcgcaaaggcatccgcacaggcatcgttgctgaacgc
tttggcggtcaagtgatggacacgttggggattgagaactttatcagtgtgaaatacaca
gaaggtcccaaactcgtggctagccttgaagaacatgtcaaagaatacggcattgatgtg
atgaccccgcagcgcgcaaagcgcctagaaaagaaagacctgatcgaggttgaacttgaa
aatggcgccgtattaaagagcaaagccgtgatcatttcaacaggggcgcgctggcgcaac
ctgggtgtgccaggtgaagctgagtttaaaaacaaaggcgtagcctattgcccccattgt
gacggacctttgtttgaagggaagcatgtagcggtgatcggcggcggcaattcaggggtt
gaggcggcgatcgatctggcaggcattgtgaagcacgtcacggtgcttgaatttatgcct
gagttgaaagctgatgccgttttgcaggagcgtctttacagtctccctaacgtaaccgtt
ctaaagaacgtgcaaacgaaagaaatcaccggcactgacaaagtgaacgggattacttac
atcgatcgggcgactgaggaagagcaccacattgaattgcagggcgtatttgttcagatc
ggcctggtacccaataccgactggttgcgggatacagtcgaatgcaatcgcttcggagag
atcatcgtggataagcatggtgccacgagcgtccctggcgtatttgcggctggggattgc
accgacagtgcttacaagcagattattatttcgatgggatcaggtgctacagctggcttg
ggtgcctttgattacctcattcgaaattaa

DBGET integrated database retrieval system