KEGG   Laceyella sacchari: C1X05_08045Help
Entry
C1X05_08045       CDS       T05304                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
lfb  Laceyella sacchari
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    C1X05_08045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AUS08801
UniProt: A0A2I7SSC2
LinkDB All DBs
Position
1580171..1580947
Genome map
AA seq 258 aa AA seqDB search
MNIEFILLLFMIGFIGSFISGMVGIGGSIIKYPLLLYIPPLLGFVAFTTHEVSGISAIQV
FFATISGVFAYRKGGYLNRSLIIYMGISILIGSFIGGYSSKLLSEEIINLVYAILATIAA
LLMFVPNKGLDDIPLNQVTFNPALAAVAAFIVGGASGIVGAAGAFILVPIMLVVLKIPTR
MTIATSLAITFISSIGSTVGKILTGQVLFLPSIIMVVASVIASPIGAMVGKKVNTKMLQV
ILAVLIVTTSIKIWLDLF
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagagtttatcttgctcctttttatgattggttttattggttctttcatatcg
gggatggtaggaattggaggctctatcattaaatatccgttgctcctatacatccctcct
ttgttggggtttgttgcttttactacccatgaagtgtctgggattagcgccatacaggta
tttttcgcaacgattagtggcgttttcgcttatcgtaaaggcggctatctaaacaggtct
ctcattatatatatgggaattagtattttgattggtagttttatcggtggatatagttcc
aagttgctcagtgaagagataatcaaccttgtttatgcgatactggctacgattgccgcg
ctcctgatgtttgtgcccaataaaggactggatgatattccactcaatcaagtaaccttt
aatcccgcactagctgccgtcgctgcttttatcgtagggggtgcttctgggatcgtaggg
gcagcaggtgcctttattttggttccgattatgcttgtcgttttgaaaatcccaactcgg
atgaccatagctacctcgctcgccattacattcatttcttccattggttcaactgtgggc
aaaatcttgacaggtcaggttcttttcttgccgtctatcattatggtagttgctagcgtg
atcgcttctccaatcggggcaatggttgggaaaaaagtaaacaccaaaatgttacaagtg
attttggctgtgttaattgtaacgacttctattaaaatttggttggatctcttttaa

DBGET integrated database retrieval system