KEGG   Laceyella sacchari: C1X05_08335Help
Entry
C1X05_08335       CDS       T05304                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
lfb  Laceyella sacchari
Pathway
lfb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    C1X05_08335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lfb03400]
    C1X05_08335
Enzymes [BR:lfb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C1X05_08335
DNA repair and recombination proteins [BR:lfb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     C1X05_08335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AUS08851
UniProt: A0A2I7SSG8
LinkDB All DBs
Position
1647665..1648618
Genome map
AA seq 317 aa AA seqDB search
MELKPIIPFEPVVTDAPPSGERWIAQVKWDGVRVLTYVENGQVKLFNRKKNERTHHYPEL
AKVSDYCTASSVILDGEVIAWREGKPSFYEVMKRDGLRQMNKVPQAMKRVPITYMVFDLL
YLDGEWMTERPLAERQAQLNQIIQPVDHVRLVPNFTDVDGLYEAVRQQGLEGIVVKDLTS
AYVIGGKDGRWRKRKVTHDLIAVVGGVTFRGKMVNSLLLGLYDDWDRLHYIGHAGTGKLT
QADWRDITECVTPLVQTEMPFYNRPERIGDAIWVTPLLTVKVHYLEWVNGHSLRQPSIQG
VVDADPLSCRGFPLSGR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggaattgaaaccaatcatcccttttgaacccgtcgtgacagatgcgccaccttcagga
gagcgctggattgctcaagtcaaatgggacggggtgcgggtgttgacgtatgttgaaaac
ggtcaggtgaaattgttcaatcggaaaaagaatgagcgaacccatcactatcctgaattg
gcgaaggtcagcgactattgcacggcttcgtctgtcattttggatggggaggtcatcgct
tggcgggaagggaagccctcgttttacgaggtgatgaaacgggatggcttacgccaaatg
aacaaagtgccgcaagcgatgaagcgggtgccgatcacctacatggtttttgatttgctt
tatctggatggcgaatggatgaccgagcgtccattggcagaacgacaagcgcagttaaac
caaatcatccagccggtggaccatgtgcggttggtgcccaacttcaccgatgttgatggc
ctgtatgaggctgtgcgccagcaagggttggaaggcattgtcgtgaaagatttgaccagt
gcttatgttattggtggaaaagatgggcgctggcgcaaacgaaaagtgacacatgacctg
atcgccgtagtaggaggggtgacgttcagagggaagatggtcaactcgcttttactgggg
ttgtacgatgattgggatcgtcttcactacatcggacatgccggcacggggaaattgact
caggcggattggcgagatatcactgaatgtgtcaccccgttggttcaaactgagatgcct
ttttacaatcggccggagcgaatcggcgacgcgatttgggtcaccccattgctcacggtt
aaagtccattatctggaatgggtgaatgggcattctttgcgacagccgagcattcagggg
gtcgtcgatgctgatccgctttcatgccgcggttttccgttatctggtaggtga

DBGET integrated database retrieval system