KEGG   Laceyella sacchari: C1X05_12360Help
Entry
C1X05_12360       CDS       T05304                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lfb  Laceyella sacchari
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lfb01001]
    C1X05_12360
Enzymes [BR:lfb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C1X05_12360
Protein kinases [BR:lfb01001]
 Serine/threonine kinases: Other
  Bacterial family
   C1X05_12360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr SPOR Kinase-like APH FTA2 Seadorna_VP7 RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AUS09531
UniProt: A0A2I7SUE8
LinkDB All DBs
Position
2524006..2525613
Genome map
AA seq 535 aa AA seqDB search
MYNKVVLFCYLLQYLFQECLQLIHKKGTARFHPRKVIAVEGKQLGGRYEILHLLGEGGMA
VVYKAKDHHLNRDVAIKIMNQKLHEGEPAIKRFIREAQTAGKFSHPNIVNVFDIGNEDDL
YYMVMELIEGPTLGDLIEERGPLPAKEAISIVMQICDGLAHAHKHGIIHRDIKPHNIMAT
ADGTYKITDFGISRLLSAATQYTKTGTVMGSVHYFSPEQACGQELNYSSDLYSLGIVLYE
LVTGDVPFDADQSVAIALKHLQHPVPDPRGKNQALPAALCDIIYKALAKKPEDRYQSAEE
FKQALQQALSAPTRALALPINRGESAEAQPPVSVTVVGAKPSKFFRFAMMGIIPLFLILG
FVYFNVSGEKALQKPQTGQVTPPEPKEQALQNVKPEATTWKEKTSGRKEQNKQTEVDEPA
PVQQNPDNDPVKEEPANEGPHGQEPGQEKPQLPQEPAPVTYEVIVDRFADQAQADECVKS
LNSKGIPAHYYEKNGDAGTVYVVSAGEFDDEELANARAEDVRNAGYPNTKVTKRS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtataataaagtggtcttattttgctatttattacaataccttttccaggaatgtttg
caactcattcacaaaaaagggacggcacgatttcatcccagaaaggtgatagcagtggaa
ggaaaacagctcggcgggaggtatgagattctccatctcttgggcgaaggcgggatggct
gtcgtatacaaggccaaggatcatcacctcaaccgcgatgtggcaattaaaatcatgaat
caaaagcttcacgaaggcgaacccgcgattaagcgatttattcgcgaagctcagacagca
gggaagttttcccatccgaacatcgtcaatgtattcgacatcggcaacgaagacgactta
tactacatggtcatggagctgatcgaaggacccaccctcggcgatctgattgaagaacga
ggccccctgcccgccaaggaagcgatttccatcgtgatgcaaatttgcgacggcttggct
cacgcccacaagcatgggattatccaccgggacatcaagccgcacaacatcatggcgacg
gccgacggaacctacaagatcaccgactttgggatttctcgtttgctaagtgcggcaacg
caatacacaaaaacgggcaccgtgatgggttcggtgcattatttctcgccggagcaggct
tgcgggcaagagctcaactactcctcagacttgtactcgctagggatcgtcctgtatgag
ttggtcacaggtgacgttccctttgatgcagaccaatcggtggccatcgccctgaaacac
ctgcaacatcccgtacccgacccgcgcggcaaaaaccaagccttgccggcggcgttatgc
gatatcatctacaaagcactggcgaaaaaaccggaagaccgctaccaatcagcggaagaa
ttcaagcaagccctgcaacaagccttgtccgccccgacacgcgcgctggcgcttccgatc
aacaggggagaaagcgctgaagcccaaccgccggtttcggtgacggtggtcggagccaaa
ccgagcaaatttttccggtttgctatgatgggaatcatcccccttttcctcatcttaggc
tttgtctatttcaacgtaagcggcgaaaaagcgctccaaaagccgcaaactgggcaggtg
actcctcctgaacccaaagagcaggcattgcaaaacgtcaagcccgaagcgacgacatgg
aaggaaaaaaccagtggccgcaaggagcaaaataagcaaacagaggtcgacgagcctgca
cctgtccagcagaaccccgataacgaccctgtgaaagaagaacccgcaaacgaaggccct
cacggtcaagagcccggccaagagaagccacaactgccacaagagccggcgccagttaca
tacgaggtcattgtcgatcggttcgcggatcaggctcaagccgatgaatgcgtcaaatcg
ttgaatagcaagggtattccggcccattattacgaaaagaacggcgatgcgggcaccgtc
tatgtggtctcggccggcgaatttgacgatgaggaactggctaacgcccgcgcagaagat
gtaagaaacgctggataccccaacacgaaagtaaccaagaggagttaa

DBGET integrated database retrieval system