KEGG   Laceyella sacchari: C1X05_14115Help
Entry
C1X05_14115       CDS       T05304                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lfb  Laceyella sacchari
Pathway
lfb00970  Aminoacyl-tRNA biosynthesis
lfb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C1X05_14115
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lfb03029]
    C1X05_14115
Enzymes [BR:lfb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C1X05_14115
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C1X05_14115
Mitochondrial biogenesis [BR:lfb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C1X05_14115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY Tcp11
Motif
Other DBs
NCBI-ProteinID: AUS09844
UniProt: A0A2I7SVG7
LinkDB All DBs
Position
complement(2858491..2859924)
Genome map
AA seq 477 aa AA seqDB search
MSKYETVIGLEVHVELSTKTKIFCGCSTEFGAPPNSHTCPVCLGHPGVLPVLNKEAVNFA
IKAAMALNCEIAEYSKFDRKNYFYPDSPKAYQISQYDQPIGQNGWIEIEVDGEKKRIGIT
RLHLEEDAGKLNHLEEGEGSLVDFNRVGVPLIEIVSEPDLRSPAEARAYLEKLKQIIQYT
GVSDVKMEEGSLRCDANISLRPVGQKEFGTKTEMKNLNSFRNVERALEYEQGRQAEMLDR
GEKITQQTLRWLENENRTKLMRSKEEAHDYRYFPEPDLVRLHISEAWKEAIRRELPELPD
ARKERYMTEFQLSDYDATILTNTKAVADYYEQVVAANVDPKLASNWVITDLLGHLNAEGK
EITDIVMTPAHLAGMIQLIQKGTISTKIAKKVFKEMLATGKEPNVIVEEKGLVQISDEGQ
LREEVTKVLAANQESVEDLKNGKDRALGFLVGQVMKATKGKANPQLVNKLIKEEIGL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatatgaaacggtgattggactggaagtccatgtggagctttccacgaaaacc
aagattttctgcggctgttctacggaattcggggctccgccaaatagccacacctgcccg
gtgtgtctgggacatcccggagtgttgccggtgctgaacaaagaagcggtcaacttcgcg
atcaaggcagccatggccttgaactgcgagatcgccgaatacagcaagttcgatcggaaa
aactacttctatccagactcacccaaagcgtatcaaatctcgcagtacgaccaacccatc
gggcaaaacggctggattgagattgaggtggatggggagaaaaaacgaatcggcatcaca
cgccttcatttggaagaggatgcaggaaagctaaaccacctggaagagggagaaggctct
ctcgtcgatttcaaccgggtcggtgtgccattgatcgagattgtgtcggagcctgatttg
cgctctccagcggaagccagagcgtatctggagaaattgaagcagatcattcaatacacc
ggtgtgtccgatgtgaagatggaagaaggctctctccgctgtgacgccaacatcagcttg
cggccggtgggacaaaaggagtttggcaccaaaacagaaatgaaaaacctcaactcgttc
cgcaatgtagagcgggcgctggaatatgaacaaggacgccaagcagagatgttggatcga
ggcgagaagatcacccagcagaccttgcgctggttggaaaatgaaaatcgcaccaagttg
atgcgcagcaaggaagaagcgcatgactaccgctatttcccagaaccggacctggtacgc
ttgcatatttcagaggcctggaaagaagcgatccgtcgcgagttgccagagttgccggat
gctcgtaaggaacgttatatgactgaattccaactgtccgactacgatgccacgattctt
accaataccaaggcggttgccgattattatgagcaagtggtcgcggccaatgtcgacccc
aaattggcctccaactgggtgattactgatctgttgggccacctcaatgcggaagggaaa
gaaatcacggacatcgtgatgacgcccgcccatctggctggcatgatccaactgatccaa
aaagggacgattagcaccaaaatcgctaaaaaagtgtttaaagagatgcttgcaaccggt
aaagaaccaaatgtgatcgtcgaagagaagggcctcgtccaaatcagcgacgaagggcag
ttgcgtgaggaagtgaccaaagtgttggcggccaaccaagagtcggtggaagacttgaaa
aacggcaaagaccgcgcactcggtttcctcgtgggtcaagtgatgaaagcgaccaaaggg
aaagccaatccgcaactggtcaacaaattgattaaagaagaaatcggactataa

DBGET integrated database retrieval system