KEGG   Lactobacillus fermentum IFO 3956: LAF_1394Help
Entry
LAF_1394          CDS       T00699                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00330  Arginine and proline metabolism
lfe01100  Metabolic pathways
lfe01110  Biosynthesis of secondary metabolites
lfe01130  Biosynthesis of antibiotics
lfe01230  Biosynthesis of amino acids
Module
lfe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lfe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LAF_1394
Enzymes [BR:lfe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     LAF_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored DapB_N NAD_binding_2 CoA_binding Shikimate_DH GFO_IDH_MocA ApbA CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: BAG27730
UniProt: B2GDJ8
LinkDB All DBs
Position
1578739..1579527
Genome map
AA seq 262 aa AA seqDB search
MTEKIAIVGVGAMGGAIAKGLYNTKQYQLLGLNPVNPRVTQLAEDLEMTVVNDPAALVNL
APGLVILTTPAPLTVATARSLANLPTTTPVVSAAAGITQEQLQAVLGDRPLATMIPNTPV
AVNAGAIGLALPQEMVEPAGTLIKEVLGSLGTVIEVKEADLDVVGVIGGCGPAFVDVMMD
ALSDGAVKHGLNRQVAYQVIAAMVAGTGKLALETGLAPALLRDQVASPGGTTIRGIDALE
QHGFRAGLIEAVDQASGGHYVD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaatcgcaattgtcggcgtaggcgccatggggggcgcgatcgccaagggg
ctatataacactaaacaataccaattactggggttaaacccggttaacccgcgggtcact
cagctggccgaggacctggagatgacggtggttaacgatccggccgccttggtcaactta
gccccgggcttggtgatcctcaccaccccggcgcccttgaccgtcgccaccgcccggtcg
ctggcgaacctaccaaccaccaccccggtggtttcggccgccgccgggatcacccaagag
cagctacaagcggtcctcggtgaccgcccgctggccaccatgatccccaacaccccggtc
gccgttaacgccggggcgatcggcctcgccctaccgcaagagatggttgaaccggccggc
accctgattaaggaggtcttgggcagcctgggcacggtgattgaagttaaggaagcagac
cttgacgtcgtgggcgtgatcggcggttgcggtccggcctttgtcgacgtgatgatggac
gccctgtccgacggggcggtcaagcacgggctcaaccgccaagtcgcctaccaagtcatc
gccgccatggtcgccgggaccgggaaactagccctggagaccggcctggccccggccctc
ttgcgcgaccaagtcgcctcgccgggtggcaccacgatccgcgggattgacgccctcgaa
cagcacggcttccgggccggcttgattgaggccgtcgaccaggcttccgggggccactat
gtcgattaa

DBGET integrated database retrieval system