KEGG   Lactobacillus fermentum F-6: LBFF_1109Help
Entry
LBFF_1109         CDS       T02669                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lff  Lactobacillus fermentum F-6
Pathway
lff00250  Alanine, aspartate and glutamate metabolism
lff00430  Taurine and hypotaurine metabolism
lff00650  Butanoate metabolism
lff01100  Metabolic pathways
lff01110  Biosynthesis of secondary metabolites
lff01120  Microbial metabolism in diverse environments
lff02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBFF_1109 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LBFF_1109 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LBFF_1109 (gadB)
   00430 Taurine and hypotaurine metabolism
    LBFF_1109 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LBFF_1109 (gadB)
Enzymes [BR:lff01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LBFF_1109 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGL89003
UniProt: R4RX42
LinkDB All DBs
Position
complement(1135184..1136587)
Genome map
AA seq 467 aa AA seqDB search
MSLYGKYDQEERNTLDPIFGSFSEDHPLPKYKLNERPVEPRIAYQVVKDQLLDEGNARLN
LATFCQTYMEPEAVKLMSETFDKNAIDKSEYPRTAEIENRCVNIIADLWHAPKDEEFMGT
STVGSSEACMLGGMAMKFSWKQRAAKLGLDVKAKRPNLVISSGYQVCWEKFCTYWDVEMR
TVPMDWEHQSLDLNHVLDYVDEYTIGIVGIMGITYTGRYDDIDALDKLVEEYNQHTDYKV
YIHVDAASGGFYTPFMEPDLKWDFRLKNVISINASGHKYGLVYPGIGWVLWRDQKCVPEK
LIFRVSYLGGEMPTMAINFSRGASQIIGQYYNFIRYGFEGYHDIHKRTHDVAVYLAQEIE
KLGLFEIVNDGSRLPIVCYRHKEDQDHEWTLYDLADRLAMKGWQVPAYPLPKDLDQIEVQ
RIVVRADFGMGMAYDFVEDMKDAIKELNGAHLVFHEKSSLKKYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcactttacggaaagtacgaccaagaagaacgtaacactctcgacccgatctttggc
tcctttagcgaggaccacccgctgccaaagtataaattgaatgaacgcccggtcgaaccg
cggattgcctaccaagtggtcaaggaccagcttttggacgaagggaacgcccgcttgaac
ctggcgaccttttgtcaaacctacatggagcccgaagccgttaagctgatgagcgagacc
ttcgataagaacgcgatcgacaagtccgagtacccgcggacggccgaaatcgagaaccgc
tgcgttaacatcatcgctgacctttggcacgctcctaaggacgaagagttcatggggacg
tcgacggttgggtcctctgaggcctgtatgctcggcgggatggcgatgaagttcagttgg
aagcaacgggccgctaagctcggtttagacgtcaaggctaagcgacccaacctagttatt
tcgtcgggttaccaggtttgctgggagaagttctgcacctactgggacgtcgaaatgcgg
acggtgccaatggactgggaacaccaatccttggaccttaaccacgtgctggactacgtc
gacgagtacacgatcgggatcgttgggatcatggggatcacctacaccgggcgctacgac
gatatcgatgccctcgacaagctggtcgaagaatacaaccagcacaccgactacaaggtt
tacatccacgtcgacgccgcctctggtggtttttataccccgttcatggaacctgacctc
aagtgggacttccggctcaagaacgtaatttcgatcaacgcttctggtcacaagtacggc
ttggtgtacccggggattggttgggtgctgtggcgcgatcaaaagtgcgtgccggaaaag
ctgatcttccgggtttcctacctgggtggcgagatgccgacgatggcgattaacttctcc
cgcggggcctcgcaaatcatcggacagtattacaacttcatccgttacggctttgaaggc
taccacgacatccacaagcggacccacgacgtcgccgtttacctggcccaagagatcgaa
aagctcggcctctttgaaatcgtcaacgacggtagccgcctgccgattgtctgctaccgc
cacaaggaggaccaagatcacgagtggaccctctacgacctggccgatcgtttggcaatg
aagggctggcaagtgccggcctacccactgcccaaggacctcgaccaaattgaagtccag
cggatcgtcgtccgcgccgacttcgggatggggatggcctacgacttcgttgaggacatg
aaggacgccattaaagaacttaacggcgcccacttggtcttccacgagaagagctccctg
aaaaagtacggctttacccactaa

DBGET integrated database retrieval system