KEGG   Leptospirillum ferriphilum ML-04: LFML04_2477Help
Entry
LFML04_2477       CDS       T02319                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
lfi00620  Pyruvate metabolism
lfi00680  Methane metabolism
lfi01100  Metabolic pathways
lfi01120  Microbial metabolism in diverse environments
lfi01200  Carbon metabolism
Module
lfi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LFML04_2477
  Energy metabolism
   00680 Methane metabolism
    LFML04_2477
Enzymes [BR:lfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LFML04_2477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 Curto_V2
Motif
Other DBs
NCBI-ProteinID: AFS54665
UniProt: J9ZD85
LinkDB All DBs
Position
2355474..2357036
Genome map
AA seq 520 aa AA seqDB search
MTKAFKSPVHHQSYLDRKIPTTMATQHPDNARAPYWKTNNDPFISTLDEIEECYRTYTDL
GCQEYMWDWEGKYVDEGVVDKLFSLYHPYFSENQLGKDVFLTFRLPNIWYEKEYRIARAY
IGILTFEELSRDLGLNSPPVFEVILPMTDEAQKMIYLKTTFRKIAKLKSQVFDETTEASD
PSYLQVIPLIEGVPQLAASHNILMEYADLHQKEYGSKPSYLRPFIARSDPALNAGFIPAT
IAAKVALSEYYKFGQESGIAIFPIMGVGSLPFRGGLNPFTVSQFLDEYPGVRTVTLQSAF
RYDYPLDSVKEAIHSLNRALPFTKPLTYTEEEIAMGERLAQLFSTIYQETVEEIADAINQ
ISSHIPPRRERKLHIGLFGYSRGIGQKRLPRAISFTGALYSLGVPPELIAIGRGIEAAIK
ENLEDALFMFCRHLKEDLRHAGHYLNRENLRFFASGNPAWERILEDIIIAEKYFKLELGP
VTTEHYLHRNIVSSIYFLTQEEKDISPYLFDAALLRRSLG
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaaagcgttcaagtcccccgtacatcatcaatcatacctggaccgcaaaattcct
acgacgatggcaacacagcacccggataatgcgagagctccttactggaaaaccaacaat
gatcctttcatcagcaccctggatgaaatcgaggaatgctacagaacctacacagatctc
ggttgtcaggaatacatgtgggactgggaagggaaatatgtggatgaaggcgttgtggac
aagcttttttccctctatcatccctatttttccgaaaatcagctcggcaaggatgttttc
ctcacatttcgccttcccaacatttggtatgaaaaagagtatcgcattgcccgggcgtat
atcggaattctgactttcgaagagttgtccagagaccttggactcaattcacccccggtt
tttgaagtgattctgccgatgacagatgaagctcaaaaaatgatttacctgaaaacgacc
tttcgcaaaattgccaaactcaaaagccaggtttttgacgaaacaacggaggccagcgac
ccgtcctatcttcaggtcatcccccttatcgaaggagtcccgcagctggcagcctcgcat
aacatcttgatggagtatgcggatcttcaccagaaagaatacggaagcaaaccgtcttat
ctcagaccttttattgcccgctcggatcccgccctgaacgccggctttattccggccacg
attgcagccaaagtcgccctgtcggaatattataagttcgggcaagaatcaggcatcgcc
atctttccgatcatgggtgtcggttctttgccttttcggggaggactgaatccgttcacg
gtctcgcagttcctggatgaatatcctggtgtccggacggtaacccttcaatccgccttt
cgctatgattatcctctcgacagcgtcaaggaagccatccattccttgaacagggctctc
ccttttacaaaacctcttacctacacggaagaagaaattgcaatgggagagaggctcgcc
caacttttttccacgatctatcaagagacagtggaagaaattgccgacgcgatcaaccag
atttcgtctcatattcctcccagaagagaacgaaaacttcatatcggtctttttggatat
tcccggggaattggacaaaaaaggcttccccgcgccattagtttcacaggggctctctac
tccctgggggttcccccggaactgatcgctatcggaagagggatcgaagcggccataaag
gaaaaccttgaagacgccctctttatgttttgcaggcatctcaaggaagatttacgccat
gcaggccattatctcaaccgcgaaaacctgcggtttttcgcctctggaaatcctgcatgg
gaacgcatactggaagatatcatcattgcggaaaaatattttaagctcgaattaggtcct
gtgacgacagagcattacctgcatcgaaacattgtttcaagcatttactttttgacccag
gaagaaaaagatatttctccatacctctttgacgcggctcttttgagacgttctttaggg
taa

DBGET integrated database retrieval system