KEGG   Limnospira fusiformis: HFV01_07245
Entry
HFV01_07245       CDS       T06534                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lfs  Limnospira fusiformis
Pathway
lfs00010  Glycolysis / Gluconeogenesis
lfs00020  Citrate cycle (TCA cycle)
lfs00620  Pyruvate metabolism
lfs01100  Metabolic pathways
lfs01110  Biosynthesis of secondary metabolites
lfs01120  Microbial metabolism in diverse environments
lfs01200  Carbon metabolism
Module
lfs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFV01_07245
   00020 Citrate cycle (TCA cycle)
    HFV01_07245
   00620 Pyruvate metabolism
    HFV01_07245
Enzymes [BR:lfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HFV01_07245
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Other DBs
NCBI-ProteinID: QJB25626
UniProt: A0A6H2AFV5
LinkDB
Position
1482090..1483364
AA seq 424 aa
MIHEVFMPALSSTMTEGKIVSWQKSPGDRVGKGETVLIVESDKADMDVEAFYEGFLATII
VPEGGTAGVGQTIALIAETEAEIEEAKKQATATAPTPSPEATPTPSVGTPEPVAATVAID
STPSRRNGRIVATPRARKLAKQLNVDLNNLQGSGPHGRIVAEDVEAATGRTQTPTVAPQP
TVSPVAPPTPIATPAPAPVPLGEVVGMNTLQNAVVRNMLASLQVPTFHVGYTITTDNLDK
LYKQVKSKGVTMTALLAKAVAVAIQKYPIVNASYVDSGIQYNKAINIAVAVAMPDGGLIT
PVLSNADQIDIYSLSRTWKDLVARARSKQLQPQEYSSGTFTLSNLGMFGVDRFDAILPPG
QGSILAIGASRPTVVATDDGMMGIKPQMQVNITCDHRIIYGADAAAFLQYLAQLIETNPQ
SLTL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgattcacgaagtgtttatgcccgccctcagttcaactatgacagagggcaaaattgta
tcgtggcaaaaatccccaggcgatcgcgtcgggaaaggggaaaccgtcctgattgtagaa
tcagataaggctgatatggatgtagaagccttttacgagggctttttagctaccattatc
gttccggaagggggaaccgctggggtcggtcaaacgatcgccctcattgccgaaacagaa
gcggaaattgaagaggccaaaaaacaagccaccgccaccgcccccaccccatcaccagaa
gctacccctaccccctctgtaggtactccagaacctgtggccgctaccgttgccatagat
agcacccctagccgtcgtaatggtcgcattgtcgctactcctcgcgctcgcaaattggcg
aaacaactcaatgtagacttaaataacctccagggtagtggcccccacggtcgcattgtg
gctgaagatgtcgaagcggctaccggaaggactcagactcctaccgttgcgcctcaacct
actgtttcccctgttgcgcctcccacacctattgccacccccgcaccagccccggttcct
ttaggggaggttgtggggatgaatactctacaaaatgccgtagtccgcaatatgttggcg
agtttgcaggttcctactttccatgtgggctacactatcactaccgacaacttggataaa
ctctataaacaggttaagtccaaaggtgtgaccatgaccgctttgctggctaaggcggtg
gcagttgctatacagaaatatcctattgtcaatgccagttatgttgactctggtattcag
tacaataaggctattaatattgctgtagcagtagccatgcccgacggtgggttaattact
cccgtactctccaatgctgatcagattgatatttattccctctctcgcacttggaaggat
ttagtcgcccgcgcccgcagcaaacaattacaaccccaagaatacagcagcggaaccttt
actctctctaacttggggatgtttggggtcgatcgctttgatgccattttgcctcccggt
cagggttcaattttggcgatcggtgcttctcgtcctactgtcgtcgccaccgatgatggc
atgatgggaattaaaccgcaaatgcaggttaacattacctgcgatcaccgtatcatctac
ggcgcagatgccgcagctttcctgcaatatctcgcccaactgattgaaactaaccctcaa
tcattaaccctgtag

DBGET integrated database retrieval system