KEGG   Lysinibacillus fusiformis: HR49_03465Help
Entry
HR49_03465        CDS       T03655                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
lfu  Lysinibacillus fusiformis
Pathway
lfu00970  Aminoacyl-tRNA biosynthesis
lfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HR49_03465
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lfu03029]
    HR49_03465
Enzymes [BR:lfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HR49_03465
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HR49_03465
Mitochondrial biogenesis [BR:lfu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HR49_03465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AJK86332
UniProt: A0A1E4R1D3
LinkDB All DBs
Position
705836..706123
Genome map
AA seq 95 aa AA seqDB search
MAKLTKEEVKHVANLARLAITEEEAEKFAEQLGKITDFAEQLNELDTANVEPTTHVLPLV
NVMREDVAVKGLDREVMMLNVKEQEDGQVKVPAIM
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaacaaaagaagaagtaaagcacgtggcaaatttagcacgtcttgcaatt
actgaagaggaagctgagaagtttgctgaacagcttggtaaaattactgactttgcagag
caattaaacgaactagatacagcaaatgttgaacctacaacgcatgttttaccattagtc
aatgtaatgcgtgaagatgttgcagtgaaaggtctagaccgtgaagtaatgatgttaaac
gtaaaagaacaagaagatggtcaagtaaaagtaccagctatcatgtaa

DBGET integrated database retrieval system