KEGG   Lysinibacillus fusiformis: HR49_12695Help
Entry
HR49_12695        CDS       T03655                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lfu  Lysinibacillus fusiformis
Pathway
lfu00020  Citrate cycle (TCA cycle)
lfu00310  Lysine degradation
lfu00380  Tryptophan metabolism
lfu01100  Metabolic pathways
lfu01110  Biosynthesis of secondary metabolites
lfu01120  Microbial metabolism in diverse environments
lfu01130  Biosynthesis of antibiotics
lfu01200  Carbon metabolism
Module
lfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HR49_12695
  09105 Amino acid metabolism
   00310 Lysine degradation
    HR49_12695
   00380 Tryptophan metabolism
    HR49_12695
Enzymes [BR:lfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HR49_12695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N PYNP_C
Motif
Other DBs
NCBI-ProteinID: AJK87937
UniProt: A0A1E4R737
LinkDB All DBs
Position
complement(2558561..2559817)
Genome map
AA seq 418 aa AA seqDB search
MAEIKVPELAESITEGSIAQWVKKVGDRVEKGEFIVELETDKVNAEIISEEAGVLTQILA
EEGDTVLVGQVIAIVEAGEGAAAAPAAAAPAEAAPAPAAPQAAPTAPVAAAPVVEETSGE
RVIASPAARRLAREKGIDLAAVSPVDPQGRVRVQDVSAHGTAPAVAAPTPVATTGGPVVF
TPAANSDRVTIEKMSRRRQTIAKRLLEVKQSTAMLTTFNEIDMTNIMALRKRKQEEFVKA
NDIKLGFMSFFTKAVVAALKKYPYVNAQIVGDELHLNNFFDIGIAVSTEEGLVVPVVRDA
NSKNFAEIEKDIASLATKAREKKLGLNDMAGGSFTITNGGVFGSLMSTPIMNGTQAGILG
MHSIVNRPVAVNGEVQIRPMMYVALSYDHRIIDGKDSVGFLKTVKELIENPEDLLLNS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaattaaagtccctgaattagcagaatcgattacagaaggtagtatcgcacag
tgggttaaaaaagtgggcgatcgcgttgaaaaaggtgaattcatcgttgaacttgaaaca
gataaagtaaacgctgaaatcatttctgaagaagcaggtgtattaacacaaattttagct
gaagaaggcgatactgtactagttggtcaagttattgctatcgtagaagcaggcgaaggc
gcagctgctgcaccagcagcggcggcaccagctgaagcagctccagctccagcagcgcca
caagcggctcctacagcaccagttgcagcagctcctgtagtagaagaaacttctggtgag
cgtgtgatcgcatctccagcggcacgtcgacttgcacgtgaaaaaggcatcgatcttgca
gcggtatctccagtagatccacaaggccgtgttcgtgtacaagatgtatcagcacatggt
acagcaccagcagtagcagcacctacaccagtagcaactacaggtggcccagttgtattc
acaccagcagctaattctgaccgtgtaacaattgaaaaaatgagccgtcgtcgtcaaaca
attgccaaacgtttattagaagttaaacaatcaacagcaatgttaacaacattcaacgaa
attgacatgacaaacatcatggcacttcgtaaacgtaaacaagaagaatttgttaaagca
aacgacatcaaacttggtttcatgtcattcttcacaaaagctgttgttgcagcactgaaa
aaatacccatatgtaaacgctcaaatcgttggcgatgaattacatttaaataacttcttt
gatatcggtattgcagtatcaactgaagaaggtttagtagtaccagttgtacgcgatgca
aacagcaaaaacttcgcagaaatcgaaaaagatatcgctagcttagcgactaaagctcgt
gagaaaaaactaggcttaaatgacatggctggtggatcattcacaatcacaaacggtggt
gtattcggttcattaatgtcaacaccaattatgaacggtactcaagctggtattttaggt
atgcactcaattgttaaccgcccagttgcggtaaatggtgaagttcaaatccgtccaatg
atgtatgtagcactttcttacgatcaccgtatcatcgatggaaaagattctgtaggattc
ttaaaaacagttaaagaattaatcgaaaaccctgaagatttattattaaattcataa

DBGET integrated database retrieval system