KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0521Help
Entry
LGAS_0521         CDS       T00410                                 

Definition
(GenBank) Dipeptide/tripeptide permease
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
lga  Lactobacillus gasseri ATCC 33323
Brite
KEGG Orthology (KO) [BR:lga00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LGAS_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1 DUF1129 SLATT_1
Motif
Other DBs
NCBI-ProteinID: ABJ59919
LinkDB All DBs
Position
548612..550108
Genome map
AA seq 498 aa AA seqDB search
MMNNSTTEKTFFGQPRGLSTLFFTEMWERFSYYGMRAILLFYMYYAVERGGLGMDETTAA
SIMSIYGSLVFLSTVAGGWLADRIWGARSTVFFGGVLIMIGHIVLALPMAELGLYISIAF
IVIGTGLLKPNVSNMVGGLYSLDDRRRDAGFSIFVFGINLGSALAPWLVPWASEGFGFNL
FGNHLNFHAGFSLAAVGMFFALVQYVWGGKKYLSDDGMQPTDPIDPATRNKLLKRVLLGV
LVLAVVLGVMAALGQLNVDNIITLITIVAIALPIYYFVLMLRSPKVTKEERSKVWAYIPL
FIAAAIFWGIEESGSVVLALFAAQRTVLHIGNWHFTAANFQTLNPLFIMILTPFFVWLWD
NWRKQPSAAGKFAAGLVFAGLSYMWMALPGMLYGTNGRVSPFWLVGSWFIVEIAEMLISP
IGLSVTTRLAPKAFRSQMMSLWFLADATGQAVNSQIVKYYSSKTEVAYFLIVGLVSVLFG
VVMFFFTKKIHNLMADAE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaataattcgacaacagagaagactttctttggtcagccacgtggcttgtctacc
ctgttcttcactgaaatgtgggagagatttagttactacggtatgcgtgctatcttactc
ttctacatgtactatgctgtagaacgtggcggtctaggcatggatgaaacaactgctgct
tcaatcatgtctatttacggctcgctagtttttctttctacggtagctggtggctggcta
gcagatagaatttggggagcgagaagtaccgtcttctttggtggtgtcctgattatgatc
gggcacattgttttagctttgccaatggcagagttaggtttatatatttcaattgcattt
attgtaattggtactggattgcttaagccgaatgtttctaacatggtaggtggtctttac
tctttagatgatcgcagaagagatgctggtttcagtatttttgtgtttggaatcaacctt
ggatccgctttagctccctggcttgttccttgggcaagtgaaggctttggttttaacctg
tttggtaatcatcttaacttccacgctggattttctttggcagcagtaggaatgttcttt
gccttagtacaatatgtatggggaggcaaaaagtatctttctgatgatggtatgcagcca
actgatccaattgatcctgcaactcgtaataaattattgaagagagtgcttttaggtgtt
ttggtcttagcagttgttttaggtgtgatggctgcgttaggtcaattaaacgttgacaat
attattactttaattactattgtggctattgctttgccaatttactactttgttttaatg
cttagaagtcctaaagtaaccaaggaagagcgctcaaaagtatgggcgtatattccatta
tttattgctgctgcgattttctggggaattgaagaatctggatcagttgttttagccttg
tttgctgcgcaaagaacggttcttcatattggaaactggcactttactgctgctaacttc
caaactttaaatccattatttattatgattttaaccccattttttgtttggctatgggat
aactggagaaaacagccgagcgctgctggcaagtttgcagctggtttagtctttgctgga
ctttcatacatgtggatggcattgccaggtatgctctatggaacaaatgggcgagttagt
ccattctggttagttggttcatggttcattgttgaaattgctgagatgcttatttcgcca
attggattatccgtaacaactcgcttggctcctaaggcattccgttctcaaatgatgagt
ctttggtttttagctgatgcaactggacaggctgttaattcgcagattgttaagtattac
tcaagtaaaactgaggtagcttatttcctaattgttggtttggtaagtgtcctgtttggt
gttgtgatgtttttctttacaaaaaagattcacaatttgatggcggacgctgagtaa

DBGET integrated database retrieval system