KEGG   Lactobacillus gasseri ATCC 33323: LGAS_1844Help
Entry
LGAS_1844         CDS       T00410                                 

Definition
(GenBank) Cytochrome bd biosynthesis ABC-type transporter, ATPase and permease component
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lga00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LGAS_1844
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lga02000]
    LGAS_1844
Transporters [BR:lga02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    LGAS_1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_membrane RsgA_GTPase AAA_29 AAA_16 SMC_N Dynamin_N AAA_7 AAA_22 AAA_15 AAA_23 MMR_HSR1 AAA_33 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ABJ61118
LinkDB All DBs
Position
1833531..1835276
Genome map
AA seq 581 aa AA seqDB search
MMNKKFSWKNERWVKPYLAQYKWNFILAIFLGVVMFFCGGALMFYAGYTIDKAATRPENI
LMIYVPIVLMRAVGIGRPLFRYLERLVSHNWILRVTSSLRRRLFYIAERNTSAVGSSFQT
GSILSLLTDDIGHLQNLYLRTIFPAILSYLVGFIVVILLGLFSWPLAGVIAILLVAELVL
VPFFSLLKQAAVRTKEKEEKAQLYTEFTDQVLGAGDWKISGRRDAFFNQTKGTLKSLGQY
EKKSGKFDWARDFGLEFIFGLMAVALLYFTNQTLTNNQEAANYVGAVVLALFPLSDAFIP
VGQGIEEWHTYSDSVKHLNELKVPENRLPAQQYFDPAFAGTLRVSNISFTYPGEDYPIIQ
NFSLTLKRGQKAALIGPSGAGKSTILQLILGDLKPRQGTVTLDRFNVLELQKERSKLFSV
LNQEPFLFNTTIYENLKMANPDASADQMMQILEKVQLADFVNSLPKKLDTEVAEAGARFS
GGQKERLALARVLLQDTQIVLLDEPTVGLDPLTEQKLLNLVFDVLKNKTVVWVTHHLQGV
KYMNEVLFFKDGKVTMQGDPHELFKHNEHFHQLYLMDQGLI
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataaaaaattttcttggaaaaatgaacggtgggtaaagccctacctagcacaa
tataaatggaattttattctagcaatttttctcggcgttgtgatgttcttttgtggtgga
gccttgatgttttatgccggctataccatcgataaagccgctacgcgtccagaaaacatt
ttgatgatttatgttcctatagttttaatgagagctgttggtattggacggcctttattt
agatatttagaacgtctggtatcccacaactggattttacgcgttactagttctttgaga
agacgcctcttttatattgctgaaagaaatacctcggctgttggctcaagttttcaaaca
ggcagcattttatcactgttgactgatgatattggacacttgcaaaatctttatttaaga
actattttcccggcaattttaagttacttagttggctttatcgttgtaattttattggga
cttttttcctggcctctagctggagtaatcgcaattttattagttgcggaattagtattg
gttcccttcttttctcttttaaagcaagctgctgttcgcactaaggaaaaagaagaaaaa
gcgcagctttacactgaatttactgatcaagttttaggcgctggtgactggaaaatttct
ggtagacgggatgcttttttcaatcaaactaaaggaactttaaaatctttaggacaatat
gaaaagaagtctggaaaatttgattgggctagagactttggtcttgaatttatttttggc
ttgatggcagttgccctcctttatttcacgaaccaaactcttaccaataatcaagaagca
gcaaattatgttggagcagttgtcttagctctctttcctttatcagatgcctttattcca
gttggacaaggaattgaagaatggcatacatatagtgattctgtaaaacacttaaatgaa
ttaaaagtaccagagaaccgtttacctgcccaacaatattttgatcctgcttttgctggc
actttaagagtttcaaatatttcatttacttatcctggagaagactatccaattattcaa
aacttttcccttaccctaaaaagaggacaaaaagcggctttaattggtccatcaggtgct
ggtaaaagtactatcctgcaattaatcttaggtgatttaaagcctcgccaaggaactgtt
acgctcgaccgctttaatgttcttgaacttcaaaaagagcgttcgaagttattttctgta
ttaaatcaagagccatttttatttaatacgacgatctatgaaaatttaaaaatggccaat
ccagacgctagtgctgatcaaatgatgcaaatcttagaaaaagtccaattagccgatttt
gttaattcactccctaagaaattagataccgaagtagctgaagctggagcacgcttttct
ggtggtcagaaagagcgtttagcactagcacgtgtacttttgcaagatacgcaaattgtc
ctcttagacgagccaacagtcggcttagatccactcacagagcaaaagctcttaaatttg
gtatttgatgtcttaaaaaataagacagtcgtttgggtaacccaccacttacaaggtgta
aaatatatgaacgaagttctcttctttaaagatggaaaagtcacaatgcaaggagatccg
catgaactctttaaacacaatgaacacttccaccaactttatttaatggatcaaggacta
atctaa

DBGET integrated database retrieval system