KEGG   Leuconostoc garlicum: A9176_00115
Entry
A9176_00115       CDS       T04802                                 

Definition
(GenBank) hypothetical protein
  KO
K02761  cellobiose PTS system EIIC component
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_00115
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_00115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_00115
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    A9176_00115
SSDB
Other DBs
NCBI-ProteinID: AQN78895
LinkDB
Position
19972..21186
AA seq 404 aa
MRYFLVNVAQRWEAKLWQMTAFQSIKTALHQSLPIIIIDIYLRLSVKLILSPNALFVKLF
KLDVQPVKPFFDTIMVLLPLADATVVLIYVIALTHQYLTANHYQNTSLPLITNCLAVFLF
FGNKNQFPVFNVNQYFVVTLIALLSSYSYTRYAIHIKHHPNPYSLPYLIWAGIIIILGLF
LHQLFRQQLFEFFLSDLWTHRFFASFLGLIIITTVAPILYLLGVALPPELTAPSSNIYGV
DRNLTTYLTTAHGALPVPENVYSVYGAFTLFGGIGNALAICLVLLYAASKQQRRLARISW
FPTLFDNSYLLFVGVPLFLNPLIFIPMILVNLMSLAISFIAITTHFIQPIVFVAPDSLPN
LLLPTVASTTPIRSLVITVIILIGSVLIYRPFLSHLTLEVSGEK
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcgctattttctagtcaatgtggcccagcgttgggaagcaaagttgtggcaaatgact
gcttttcaaagtatcaaaacagcattacatcaatctctaccaattattattattgatatt
tatttacgcttatcagttaagcttattctatcgcccaatgcgctattcgtcaaattattt
aaacttgatgtgcaaccagtcaaaccattttttgataccataatggtactgttaccgctt
gcagatgcaacggttgtcctaatttacgtcatcgctctgacgcatcagtacctgaccgct
aatcattatcaaaataccagtctccctttgattacgaactgcttggcggttttcttattt
tttggcaataaaaatcaattccctgtctttaacgtcaatcaatactttgttgtcaccttg
attgccttattgagtagctactcttacacccgctatgccattcatatcaagcatcatcct
aatccctacagtttgccttatctcatttgggcaggcattattattattctgggtctattt
ttacaccaacttttccggcaacaactctttgagttcttcttatccgatctgtggacacat
cgcttctttgcctcgttcttaggccttatcattattacgactgtggcgccgatactgtac
cttttgggtgtggcgctaccaccagaacttactgcgccatcatcaaacatttatggtgtt
gatcgaaatctcaccacctatctcaccactgcacacggcgccttacctgtaccggaaaac
gtatatagtgtttatggcgcctttacgttatttggcggcattggtaatgcgttagccatt
tgtcttgtcttattatatgccgcttccaagcaacaacgtcgtctagcgagaatttcttgg
ttcccaacgttatttgataatagttacctgttgtttgtcggggtgccactctttttgaac
cccttgattttcatcccgatgattttagttaatctgatgagtttagccattagttttatt
gccatcacaacccatttcatccaacccattgtctttgtcgcacccgacagcttgccaaac
ctgctattgccaacggttgctagtacgacgccaattcgttcactcgtgattacggtaatc
attttgattggttcagttctcatctatcgccccttcttatcccatctgactctggaggta
tccggtgaaaaataa

KEGG   Leuconostoc garlicum: A9176_05105
Entry
A9176_05105       CDS       T04802                                 

Definition
(GenBank) hypothetical protein
  KO
K02760  cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_05105
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_05105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_05105
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     A9176_05105
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     A9176_05105
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    A9176_05105
SSDB
Motif
Pfam: PTS_IIB Sec2p Oxidored_nitro
Other DBs
NCBI-ProteinID: AQN80395
LinkDB
Position
998513..998833
AA seq 106 aa
MGNKKLLLVGDQTPTITRLVSAIKKAATAQEKSYTIVVTSHSHVDEQLRAAQPDIVLLTP
QLAYLKAEMQRQTDEFGVPLAVIKLSDYTQMAGDHILLIAEQLLVT
NT seq 321 nt   +upstreamnt  +downstreamnt
atgggtaacaagaaattgctgttagttggtgatcagacgccaacgatcacccgactggtg
tcggcaataaaaaaagcagccacggcacaagaaaaaagctatacgattgttgtgacttcc
cactcccatgttgacgagcaattgcgtgcggcgcagccagatattgttttactgacacct
caattagcgtatctcaaggcggaaatgcaacgtcaaactgatgagtttggggtgccacta
gcagtgattaagttaagtgattatacgcaaatggctggtgatcacatcttgttaatagcc
gaacagttgctggttacttag

KEGG   Leuconostoc garlicum: A9176_06555
Entry
A9176_06555       CDS       T04802                                 

Definition
(GenBank) PTS cellobiose transporter subunit IIC
  KO
K02761  cellobiose PTS system EIIC component
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_06555
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_06555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_06555
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    A9176_06555
SSDB
Motif
Pfam: PTS_EIIC
Other DBs
NCBI-ProteinID: AQN80026
LinkDB
Position
1299379..1300701
AA seq 440 aa
MAKLSDTLNNKVIPVVMRFVNTRPITAMKNGMLYPIPFIIVGAIFLILGQFPYQPVAAYF
TKIGIDDWFMQAYNGSFAIMALFAVFGITYSWVHDSGYDGVPAGLLAIVTDIILQPNHVT
TVANVLDKTKTSTNWMAENAIDKAWLGGKGMILAIIIGMLVGWIYTWFMKKGITIKLPEQ
VPSNVAASFTALVPAAAIITGATIVYGLFQKLGNTTFAEWIYRIIQTPLQHASDGPFGVL
LITLVPVFLWFFGVHGSTIVSGIMQPLLISNNADNLTLYQAGKLSLDNGAHIVTQSFFEQ
FITVTGAGVTIGLVVYMIIGAKSVQMKTLAKLEIGPGLFNINEPVLFGIPLVLNPVMVVP
FILAPVVTGFSTYYAIKFGIIPPLNGVYVPWTTPPVISGFIVGGWKVMLWQIFMLAITIP
IYWPFAQKYDKILVAQEKAV
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcaaaactgtcagatactttaaacaacaaggtgattccggttgtgatgaggtttgtg
aatacacgcccgatcacagcgatgaaaaacggtatgttatatccaattccgtttatcatt
gttggggcaatttttctgatcttgggacaattcccatatcaacccgtcgcagcctatttc
acgaaaattggcattgatgattggttcatgcaagcgtacaacggctcgtttgcgatcatg
gcgctgtttgcagtctttgggattacgtactcatgggtgcatgactcagggtatgatggg
gttccagctggattgttagcgattgtcacggatattatcttgcaacccaatcatgtcaca
acggttgccaatgtcttagataagacgaagacatccactaattggatggcagaaaatgcc
attgataaagcttggcttggtggtaaaggcatgatcttagccattattatcgggatgttg
gttggttggatttatacctggttcatgaagaagggtattacgatcaaactaccagaacaa
gtgccaagtaacgtagcggcttcatttacagcattggtgccggccgctgccattatcact
ggtgcgaccattgtgtacggattgttccagaagctagggaacaccacatttgcagaatgg
atttaccgcattatccaaacaccgctgcaacacgcatcagatggcccattcggggtattg
ttaattaccttagtgccggtattcctttggttcttcggggtccatggttcaacaattgtt
tccggcattatgcaacctttgttgattagtaacaacgcggacaacttgacgttgtatcaa
gctggaaaattgtcattagacaacggcgcacatattgtgacccaatcattcttcgaacag
tttatcacagtcactggtgctggggttacaattggcttggtggtgtatatgatcattggc
gcaaagtcagtgcagatgaaaacattggctaaattagaaattgggccaggactcttcaac
attaacgaacctgttttgttcgggattccactggtgttgaaccctgtgatggttgtgcca
ttcatcttagcacccgtcgtgactggtttcagcacgtattatgcgattaaatttggcatt
atcccaccattaaacggggtgtatgtaccttggacaacaccaccagttatttctggcttc
atcgtcggtggttggaaagtgatgctttggcaaatcttcatgttggcgatcacgatccca
atttattggccatttgcacaaaagtacgacaaaattttggtggcccaagaaaaggcagtt
taa

KEGG   Leuconostoc garlicum: A9176_06560
Entry
A9176_06560       CDS       T04802                                 

Definition
(GenBank) PTS sugar transporter subunit IIB
  KO
K02760  cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_06560
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_06560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_06560
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     A9176_06560
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     A9176_06560
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    A9176_06560
SSDB
Motif
Pfam: PTS_IIB
Other DBs
NCBI-ProteinID: AQN80027
LinkDB
Position
1300783..1301100
AA seq 105 aa
MATKTIMLACAAGMSTSMLVSKMQSAASAQGKDYDIFATSTSDVDNALAQRHPDVLLLGP
QVAYLKNEVKAKTDAAGVPMDIINMMDYGMMKGDNVLATAEKIMG
NT seq 318 nt   +upstreamnt  +downstreamnt
atggcaacaaagacaattatgttagcatgtgcagcggggatgtcaacctcaatgctcgtt
tcaaagatgcaaagtgcagcatcggcacaagggaaagattatgacatttttgccacctca
acatctgatgttgacaatgccttagcacaacgccatccagatgtgttattactcggacca
caggtggcttacttaaagaatgaggttaaagcaaagaccgatgcagccggtgtcccaatg
gatatcatcaatatgatggattacgggatgatgaagggcgacaatgttttggcaactgcg
gaaaagatcatgggttaa

KEGG   Leuconostoc garlicum: A9176_06565
Entry
A9176_06565       CDS       T04802                                 

Definition
(GenBank) PTS cellobiose transporter subunit IIA
  KO
K02759  cellobiose PTS system EIIA component [EC:2.7.1.196 2.7.1.205]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
lgc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_06565
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A9176_06565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgc02000]
    A9176_06565
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     A9176_06565
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     A9176_06565
Transporters [BR:lgc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component
    A9176_06565
SSDB
Motif
Pfam: PTS_IIA
Other DBs
NCBI-ProteinID: AQN80028
LinkDB
Position
1301106..1301420
AA seq 104 aa
MNDERMVVIMGLILNGGDAKSHAFQAIQLAKTGDFAGARTEIQAADEALKTAHDIQTDML
TKAAQGEYIEVDLYMLHAQDHLMNGITFRDLAVEIIALYERQAG
NT seq 315 nt   +upstreamnt  +downstreamnt
atgaatgatgaacgaatggtagtcattatgggcttaattttgaatggtggcgatgcgaaa
tcacacgcgtttcaagccattcaattggctaagactggggactttgcaggtgcacgtact
gaaatacaggcagccgatgaagcgcttaaaacagcacatgatatccaaacagatatgctg
acgaaagcagcacaaggggaatacattgaagtcgatttgtatatgttgcatgcgcaagat
cacttaatgaatgggattaccttccgagatttagcagttgaaattattgcgctttacgaa
cgccaagcaggctaa

DBGET integrated database retrieval system