KEGG   Leuconostoc garlicum: A9176_00145
Entry
A9176_00145       CDS       T04802                                 

Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00010  Glycolysis / Gluconeogenesis
lgc00030  Pentose phosphate pathway
lgc00052  Galactose metabolism
lgc00230  Purine metabolism
lgc00500  Starch and sucrose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc00521  Streptomycin biosynthesis
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01120  Microbial metabolism in diverse environments
Module
lgc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9176_00145
   00030 Pentose phosphate pathway
    A9176_00145
   00052 Galactose metabolism
    A9176_00145
   00500 Starch and sucrose metabolism
    A9176_00145
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_00145
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A9176_00145
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A9176_00145
Enzymes [BR:lgc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     A9176_00145
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2045
Other DBs
NCBI-ProteinID: AQN78901
LinkDB
Position
complement(26436..28136)
AA seq 566 aa
MHYQETLAQWQAADLPDYLADELASYTPEQQEEAFYQNLSFGTAGMRGVLGAGTNRMNIF
TVRQVTEALARYIASQGDEAKKRGVVISFDSRHFSPEFAADAAKVLSAHQIKVYLFSSLR
PTPELSFAVRELGTFAGIMITASHNPKEYNGYKVYGEDGGQMVPEAVDAVVNELAGISDI
FNIALDEDQTYVEVIDQAIDEKYLAAMKTVTVDPELVAKEGKSLKFVYSPLHGTGQYIGE
KALQQAGFTNYTIVKEQAVIDGDFPTVAKPNPEDAAALEMAIAYAKETGADAVVATDPDA
DRMGAAVRLADGTFQVLTGNQIAAVLVNYLLTAKQNTGTLPDNGAIVTSIVSSRFASKIA
ESFGVTTADVLTGFKYIAATIDEYEATQEKTFLFGFEESFGYLVKPFAHDKDAIQALVLF
AEVAAYYKSQSQTFADGLQALFDKYGYFEEKTISLDFPGVHGNDDMAKIIAKFRDHQPET
IGGIAVSRVQDFSTGLETDADGQVTTLTQPKANVLKYWLADGSWVAVRPSGTEPKLKFYI
GVTSDSQAASQAKIDTITADLMTYTK
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgcattatcaagaaactttagcacagtggcaagcggcagatttgcctgactatttggcc
gatgagcttgcctcatatacaccagagcagcaagaagaagctttttatcaaaatttgagc
tttggaacagcaggtatgcgtggtgttttgggtgcgggaactaaccgaatgaacatcttc
acggtacgccaagttaccgaagccctagcgcgttatattgcgtcacaaggagatgaagcg
aaaaagcgtggcgttgtgattagttttgattcacgccatttttcacctgaatttgcagct
gacgcagctaaagttttgtcagcacatcaaatcaaagtttatctctttagtagcttgcgg
ccaacgccggaactgtcttttgctgtgcgagaattggggacatttgctggtatcatgatt
acggcatcacacaatcccaaggaatacaatggctataaggtttatggtgaagatggtggc
caaatggtaccggaagccgtcgatgctgtcgtgaatgaattagctggcatctctgatatc
tttaatattgcccttgatgaagaccaaacttacgttgaagtgattgatcaagccattgac
gagaaatatttggcagctatgaagacagtcacggttgatcctgaattggttgctaaagaa
gggaaatcgttaaagtttgtctactcaccactgcacggaaccggtcaatatattggggaa
aaggccttgcaacaagcgggctttaccaactatacgattgtgaaagaacaagctgtgatt
gatggcgactttccaactgttgccaagccaaacccagaagatgcagcggcattagaaatg
gccattgcttacgctaaggaaacaggtgccgatgcggtcgttgccacagatcccgatgct
gaccggatgggggctgctgttcgtttagccgatgggactttccaagtcttgactggtaac
caaattgccgctgttttggtgaattatttgttgacagccaagcaaaacaccggcacattg
ccagataatggggcgattgtgacgtcaattgtgtcgtcacgttttgcctcaaagattgct
gagagctttggcgtgacaacagctgatgtgttgactggctttaagtacatcgcggcaacc
attgacgaatatgaagcaacacaagaaaagacgttcttatttggttttgaagagagtttt
ggctatctcgttaagccttttgcccacgataaagatgccattcaagccctcgtgttgttt
gcagaagtagcggcttactataagtcacaaagccaaacatttgcggatggtttgcaagct
ttgtttgacaagtacggctattttgaagaaaagacgattagtttggacttcccaggtgtg
catggcaatgacgatatggcaaaaatcattgccaagttccgtgatcatcaaccggaaacg
attggggggattgctgttagccgcgtgcaagacttctcgactggtctagaaactgatgct
gatggtcaagtcacaacattgacacagccaaaagctaatgtcttgaagtattggttagct
gatggctcatgggtggctgtacgcccatcagggactgaaccaaagttgaagttctatatt
ggggtcacttctgattcacaagctgcttcacaagccaaaattgacacgatcacagcagat
ttgatgacttatacaaaataa

DBGET integrated database retrieval system