KEGG   Leuconostoc garlicum: A9176_00155
Entry
A9176_00155       CDS       T04802                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K00690  sucrose phosphorylase [EC:2.4.1.7]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00500  Starch and sucrose metabolism
lgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9176_00155
Enzymes [BR:lgc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     A9176_00155
SSDB
Motif
Pfam: Alpha-amylase CFSR
Other DBs
NCBI-ProteinID: AQN78903
LinkDB
Position
complement(28903..30357)
AA seq 484 aa
MKKLTNEVMLITYADSLGKNLKELDQVLSNELDGVVGGVHVLPFFPSTGDRGFAPEEYET
VDPKFGDWSDIDKLAEKYYLMFDFMLNHISPQSKYFQDFLEKKEDSEYYDMFLKYSEFWP
ENRPTAEDIDLIYKRKDKAPFAPVTFADGTTDQVWNTFGDQQMDLDVTKPVTKQFIKDSL
INLARHGASVIRLDAFAYAIKKLDTNDFFVEPEIWDVLNEVREILAAEGSEVLPEIHEHY
KIVRKITDHDMYSYDFALPLITLYSLYSGKTNRLADWLRQSPMKQFTTLDTHDGIGVVDA
KDLLTQEETDFTTEEMYKVGANVKKIFSSAAYNNLDIYQINTTYYSALGNDDAAYLLARA
TQIFAPGIPQVYYVGLLAGENDLELLESTKEGRNINRHYYDLEEIAETVKRPVVSNLFDL
LRFRNTSSAFDLDGEIKVENNGDNDLTITRTSADGQTTAVLTADFATKQFKVTENDKVIF
NTQA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaaaaagctcaccaatgaagtgatgctcattacatatgctgactcacttggtaagaat
ttgaaggaattggatcaagtgttgtcaaatgaattggatggtgttgttggtggtgtccac
gttttgccattcttcccatcaacaggcgaccgtggctttgcccctgaagaatatgaaaca
gttgatccaaagtttggggactggtctgacattgacaagttagctgagaagtactacttg
atgtttgacttcatgttgaaccacatttcaccacaatcaaagtatttccaagacttctta
gaaaagaaggaagactcagaatactatgacatgttcttgaagtattctgaattctggcct
gaaaaccgcccaacagccgaagatatcgatttgatttataagcgtaaggataaggcacca
tttgcgcccgtaacatttgcggacggcacaacagaccaagtttggaacacattcggtgac
caacaaatggatttggatgtcacaaagccagtgacaaagcaattcatcaaggattcattg
attaaccttgcccgtcatggtgcgtcagtgattcgtttggatgcctttgcttacgctatc
aagaagttggatacaaacgacttcttcgttgaaccagaaatctgggacgttttgaacgaa
gtacgtgaaatcttggcagcagaaggttctgaagttttgccagaaattcatgaacactac
aagattgtgcgcaagattacggatcacgacatgtattcatatgactttgcgttgccattg
attacgttgtactcactttattcaggtaagacaaaccgtttggctgattggttgcgtcaa
agcccaatgaagcaatttacaacattggatacacacgatggtattggtgttgttgatgcc
aaggacttgttgacacaagaagaaacagactttacaacggaagaaatgtacaaggttggg
gctaacgtgaagaagatcttctcatcagcagcctacaataacttggatatttaccaaatt
aatacaacttattactcagctttgggtaatgacgatgccgcttacttgctagcacgtgcg
acacaaatctttgcaccaggtatcccacaagtttattacgttggtttgttggcaggtgaa
aacgaccttgaattgttggaaagcacaaaggaaggccgtaacatcaaccgtcactattac
gaccttgaagaaattgctgaaacagttaagcgtccagttgtgtcaaacttgtttgacttg
cttcgcttccgtaacacaagctcagcctttgatcttgatggtgagattaaggttgaaaac
aatggtgacaatgatttgacaattacacgtacatcagctgatggtcaaacaactgccgtt
ttgacagctgactttgcgacaaagcaattcaaagtcactgaaaatgataaagtaattttc
aacacacaggcttaa

DBGET integrated database retrieval system