KEGG   Leuconostoc garlicum: A9176_00170
Entry
A9176_00170       CDS       T04802                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00040  Pentose and glucuronate interconversions
lgc00052  Galactose metabolism
lgc00500  Starch and sucrose metabolism
lgc00520  Amino sugar and nucleotide sugar metabolism
lgc00541  O-Antigen nucleotide sugar biosynthesis
lgc01100  Metabolic pathways
lgc01110  Biosynthesis of secondary metabolites
lgc01240  Biosynthesis of cofactors
Module
lgc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A9176_00170
   00052 Galactose metabolism
    A9176_00170
   00500 Starch and sucrose metabolism
    A9176_00170
   00520 Amino sugar and nucleotide sugar metabolism
    A9176_00170
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    A9176_00170
Enzymes [BR:lgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A9176_00170
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: AQN78906
LinkDB
Position
complement(32951..33823)
AA seq 290 aa
MKPVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREAIASGIEEIVIVDGKS
KRSIEDHFDSNPELENNLREKGKDELLKIVQETTDINMYFIRQSHPKGLGDAVLTAKAFI
GDEPFVVLLGDDLMEDDVPLTKQLIDRYEETGESTLAVMKVPHDQVSEYGVIDPAAEASK
GLFRVKTFVEKPKPEDAPSDLAIIGRYLLTPEIFEELENTTPGKGGEIQLTDAIDSLNNR
QHVYAHEFKGNRYDIGSKIGFLETNIEFGLKHPQTKDQLRAYIKELAAKL
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaaaccagtacgtaaggcaattattccagcagcaggacttgggacacgttttttgcca
gccacaaaagctttggcaaaggaaatgttaccaattgttgatacaccaacgattgaatat
atcgtgcgtgaagcgattgcctcaggtatcgaagagattgtgattgttgatggtaagtca
aagcgatcaattgaagaccactttgattcaaatccagaattggaaaacaacttgcgcgaa
aaaggtaaggacgaattactcaagattgtgcaagaaacaacggacattaacatgtacttt
attcgtcagtcacacccaaagggcttaggggatgcggtcttaacagccaaggcctttatt
ggagacgaacctttcgtcgtgttacttggtgatgatttgatggaagatgatgtgccattg
acaaagcaattgattgaccgttatgaagaaactggtgaatcaactttggcggtaatgaaa
gtaccacatgaccaagtgtcagaatacggggtgattgacccagccgctgaagcttcaaag
ggccttttccgcgttaagacattcgtggaaaagcctaagccagaagatgcaccttctgac
ttggctattattggacgttacttgttaacaccggaaatttttgaagaactcgagaacaca
acacctggtaagggtggtgaaatccaattaacggatgccattgattcattgaataaccgt
cagcacgtttatgcccatgaattcaagggaaatcgttatgacattggctcaaagattggt
ttcttggaaactaatattgaatttggcttgaagcacccacaaaccaaagatcaattacgc
gcttacatcaaggaacttgctgccaagttgtaa

DBGET integrated database retrieval system